PDB entry 6cpw

View 6cpw on RCSB PDB site
Description: Discovery of 3(S)-thiomethyl pyrrolidine ERK inhibitors for oncology
Class: TRANSFERASE/TRANSFERASE inhibitor
Keywords: transferase, serine/threonine-protein kinase, map kinase, transferase-transferase inhibitor complex
Deposited on 2018-03-14, released 2018-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Mapk1, Erk2, Mapk, Prkm1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cpwa_
  • Heterogens: SO4, F8V, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cpwA (A:)
    mahhhhhhmaaaaaagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaik
    kispfehqtycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlyk
    llktqhlsndhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarva
    dpdhdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyl
    dqlnhilgilgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkml
    tfnphkrieveqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarf
    qpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cpwA (A:)
    vfdvrytnlsyigegaygmvcsaydrvaikkispfehqtycqrtlreikillrfrhenii
    gindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyflyqilrglkyihsan
    vlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvatrwyrapeimlnskg
    ytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnciinlkarnyl
    lslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyleqyydpsdepi
    aeapflddlpkeklkelifeetarfqpg