PDB entry 6cpm

View 6cpm on RCSB PDB site
Description: Structure of the USP15 deubiquitinase domain in complex with a third-generation inhibitory Ubv
Class: signaling protein
Keywords: deubiuqitination, Ubv, high-affinity, inhibition, SIGNALING PROTEIN
Deposited on 2018-03-13, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: ubiquitin carboxyl-terminal hydrolase 15
    Species: Homo sapiens [TaxId:9606]
    Gene: USP15, KIAA0529
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y4E8 (Start-200)
    • Uniprot Q9Y4E8 (201-282)
      • linker (283)
    • Uniprot Q9Y4E8 (284-345)
      • expression tag (346-348)
    Domains in SCOPe 2.07: d6cpmc1, d6cpmc2
  • Chain 'D':
    Compound: ubiquitin carboxyl-terminal hydrolase 15
    Species: Homo sapiens [TaxId:9606]
    Gene: USP15, KIAA0529
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y4E8 (Start-200)
    • Uniprot Q9Y4E8 (201-282)
      • linker (283)
    • Uniprot Q9Y4E8 (284-345)
      • expression tag (346-348)
    Domains in SCOPe 2.07: d6cpmd1, d6cpmd2
  • Chain 'E':
    Compound: Ubiquitin variant 15.1d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CPM
    Domains in SCOPe 2.07: d6cpme_
  • Chain 'F':
    Compound: Ubiquitin variant 15.1d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CPM
    Domains in SCOPe 2.07: d6cpmf_
  • Heterogens: CA, ZN, NA, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cpmC (C:)
    sgaaadysepgrnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfd
    nplgmrgeiaksyaelikqmwsgkfsyvtprafktqvgrfapqfsgyqqqdcqellafll
    dglhedlnrirkkpyiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcp
    ecakisvtfdpfcyltlplpmpkkpfvklkdcielfttkeklgaedpwycpnckehqqat
    kkldlwslppvlvvhlkrfsysrymrdkldtlvdfpindldmsgcrynliavsnhyggmg
    gghytafaknkddgkwyyfddssvstasedqivskaayvlfyqrqdssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cpmC (C:)
    sepgrnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfdnplgmrg
    eiaksyaelikqmwsgkfsyvtprafktqvgrfapqfsgqdcqellaflldglhedlnri
    rkkpyiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcpecakisvtfd
    pfcyltlplpmpkkpfvklkdcielfttkeklgaedpwycpnckehqqatkkldlwslpp
    vlvvhlkrfsysrymrdkldtlvdfpindldmsgcrynliavsnhyggmggghytafakn
    kddgkwyyfddssvstasedqivskaayvlfyqrqdssg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cpmD (D:)
    sgaaadysepgrnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfd
    nplgmrgeiaksyaelikqmwsgkfsyvtprafktqvgrfapqfsgyqqqdcqellafll
    dglhedlnrirkkpyiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcp
    ecakisvtfdpfcyltlplpmpkkpfvklkdcielfttkeklgaedpwycpnckehqqat
    kkldlwslppvlvvhlkrfsysrymrdkldtlvdfpindldmsgcrynliavsnhyggmg
    gghytafaknkddgkwyyfddssvstasedqivskaayvlfyqrqdssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cpmD (D:)
    grnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfdnplgmrgeia
    ksyaelikqmwsgkfsyvtprafktqvgrfapqfsqdcqellaflldglhedlnrirkkp
    yiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcpecakisvtfdpfcy
    ltlplpmpkkpfvklkdcielfttkeklgaedpwycpnckehqqatkkldlwslppvlvv
    hlkrfsysrymrdkldtlvdfpindldmsgcrynliavsnhyggghytafaknkddgkwy
    yfddssvstasedqivskaayvlfyqrqdssg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6cpmE (E:)
    gaaamqifvktptgkfislevepsdtienvkakiqdkegippdqqrlifrqtwaskqled
    grtlsdyniqkestlhlvlrlrgssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cpmE (E:)
    aamqifvktptgkfislevepsdtienvkakiqdkegippdqqrlifrqtwaskqledgr
    tlsdyniqkestlhlvlrl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6cpmF (F:)
    gaaamqifvktptgkfislevepsdtienvkakiqdkegippdqqrlifrqtwaskqled
    grtlsdyniqkestlhlvlrlrgssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cpmF (F:)
    aamqifvktptgkfislevepsdtienvkakiqdkegippdqqrlifrqtwaskqledgr
    tlsdyniqkestlhlvlr