PDB entry 6cpj

View 6cpj on RCSB PDB site
Description: Solution structure of SH3 domain from Shank2
Class: protein binding
Keywords: PSD, scaffold protein, postsynaptic density, PROTEIN BINDING
Deposited on 2018-03-13, released 2018-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 and multiple ankyrin repeat domains protein 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Shank2, Cortbp1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QX74 (1-59)
      • initiating methionine (0)
      • expression tag (60)
    Domains in SCOPe 2.08: d6cpja1, d6cpja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cpjA (A:)
    mvpgrlfvaikpyqpqvdgeiplhrgdrvkvlsigeggfwegsarghigwfpaecveevq
    s