PDB entry 6cph

View 6cph on RCSB PDB site
Description: Crystal structure of a TCR
Class: immune system
Keywords: tcr, immune receptor, immune system
Deposited on 2018-03-13, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: TcR alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CPH
    Domains in SCOPe 2.07: d6cphd1, d6cphd2
  • Chain 'E':
    Compound: TCR beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CPH (Start-244)
    Domains in SCOPe 2.07: d6cphe1, d6cphe2
  • Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cphD (D:)
    ilnveqspqslhvqegdstnftcsfpssnfyalhwyrwetakspealfvmtlngdekkkg
    risatlntkegysylyikgsqpedsatylcafkaagnkltfgggtrvlvkpniqnpdpav
    yqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks
    dfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cphD (D:)
    lnveqspqslhvqegdstnftcsfpssnfyalhwyrwetakspealfvmtlngdekkkgr
    isatlntkegysylyikgsqpedsatylcafkaagnkltfgggtrvlvkpniqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffps
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6cphE (E:)
    epevtqtpshqvtqmgqevilrcvpisnhlyfywyrqilgqkveflvsfynneiseksei
    fddqfsverpdgsnftlkirstkledsamyfcassrlaggmdeqffgpgtrltvledlkn
    vfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplke
    qpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaea
    wgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cphE (E:)
    pevtqtpshqvtqmgqevilrcvpisnhlyfywyrqilgqkveflvsfynneisekseif
    ddqfsverpdgsnftlkirstkledsamyfcassrlaggmdeqffgpgtrltvledlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    grad