PDB entry 6cpg

View 6cpg on RCSB PDB site
Description: Structure of dephosphorylated Aurora A (122-403) in complex with inhibiting monobody and AT9283 in an inactive conformation
Class: transferase/inhibitor
Keywords: protein kinase, DFG-loop, monobody, AT9283, TRANSFERASE, transferase-inhibitor complex
Deposited on 2018-03-13, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cpga_
  • Chain 'B':
    Compound: monobody
    Species: artificial [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CPG (Start-92)
  • Chain 'D':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cpgd_
  • Chain 'E':
    Compound: monobody
    Species: artificial [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CPG (Start-92)
  • Heterogens: 35R

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cpgA (A:)
    svdeskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehql
    rreveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyit
    elanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylpp
    emiegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegard
    lisrllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cpgA (A:)
    qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadfgwcgtldylppemiegrmhdekvdlwslgvl
    cyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevl
    ehpwitans
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cpgD (D:)
    svdeskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehql
    rreveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyit
    elanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylpp
    emiegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegard
    lisrllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cpgD (D:)
    qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadfgwslcgtldylppemiegrmhdekvdlwslg
    vlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlre
    vlehpwitanss
    

  • Chain 'E':
    No sequence available.