PDB entry 6cpe

View 6cpe on RCSB PDB site
Description: Structure of apo, dephosphorylated Aurora A (122-403) in an active conformation
Class: transferase
Keywords: protein kinase, DFG-loop, transferase, cell cycle
Deposited on 2018-03-13, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cpea_
  • Heterogens: P4G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cpeA (A:)
    svdeskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehql
    rreveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyit
    elanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylpp
    emiegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegard
    lisrllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cpeA (A:)
    qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadfgwsvhapsstldylppemiegrmhdekvdlw
    slgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpm
    lrevlehpwitanssk