PDB entry 6cod

View 6cod on RCSB PDB site
Description: AtHNL enantioselectivity mutant At-A9-H7 Apo Y13C,Y121L,P126F,L128W,C131T,F179L,A209I with benzaldehyde
Class: lyase
Keywords: alpha beta hydrolase globular hydroxynitrile lyase, LYASE
Deposited on 2018-03-12, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-hydroxynitrile lyase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HNL, MES5, At5g10300, F18D22_70
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LFT6 (0-257)
      • engineered mutation (13)
      • engineered mutation (121)
      • engineered mutation (125)
      • engineered mutation (128)
      • engineered mutation (131)
      • engineered mutation (209)
      • expression tag (258)
    Domains in SCOPe 2.07: d6coda1, d6coda2
  • Chain 'B':
    Compound: Alpha-hydroxynitrile lyase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HNL, MES5, At5g10300, F18D22_70
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LFT6 (0-257)
      • engineered mutation (13)
      • engineered mutation (121)
      • engineered mutation (125)
      • engineered mutation (128)
      • engineered mutation (131)
      • engineered mutation (209)
      • expression tag (258)
    Domains in SCOPe 2.07: d6codb1, d6codb2
  • Heterogens: HBX, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6codA (A:)
    merkhhfvlvhnachgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeysk
    plietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvld
    klmemfggwgdtefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsff
    tedlskkekfseegygsvqrvyvmssedkiipcdfirwmidnfnvskvyeidggdhmvml
    skpqklfdslsaiatdymgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6codA (A:)
    merkhhfvlvhnachgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeysk
    plietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvld
    klmemfggwgdtefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsff
    tedlskkekfseegygsvqrvyvmssedkiipcdfirwmidnfnvskvyeidggdhmvml
    skpqklfdslsaiatdymg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6codB (B:)
    merkhhfvlvhnachgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeysk
    plietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvld
    klmemfggwgdtefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsff
    tedlskkekfseegygsvqrvyvmssedkiipcdfirwmidnfnvskvyeidggdhmvml
    skpqklfdslsaiatdymgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6codB (B:)
    merkhhfvlvhnachgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeysk
    plietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvld
    klmemfggwgdtefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsff
    tedlskkekfseegygsvqrvyvmssedkiipcdfirwmidnfnvskvyeidggdhmvml
    skpqklfdslsaiatdymg