PDB entry 6co2

View 6co2 on RCSB PDB site
Description: Structure of an engineered protein (NUDT16TI) in complex with 53BP1 Tudor domains
Class: protein binding
Keywords: Designer protein, Engineered protein, NUDT16TI, NUDT16, 53BP1, TIRR, Tudor domain, RNA binding, Protein binding, RNA nucleotide diphosphatase
Deposited on 2018-03-10, released 2018-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NUDT16-Tudor-interacting (NUDT16TI)
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96DE0
      • conflict (4)
      • conflict (21)
      • conflict (99-101)
      • insertion (104)
  • Chain 'B':
    Compound: NUDT16-Tudor-interacting (NUDT16TI)
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96DE0
      • conflict (4)
      • conflict (21)
      • conflict (99-101)
      • insertion (104)
  • Chain 'C':
    Compound: TP53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6co2c1, d6co2c2
  • Chain 'D':
    Compound: TP53-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53BP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6co2d1, d6co2d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >6co2C (C:)
ghmnsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipl
dtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqy
glg

    Sequence, based on observed residues (ATOM records): (download) 
    >6co2C (C:)
sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldtev
talsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqygl

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >6co2D (D:)
ghmnsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipl
dtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqy
glg

    Sequence, based on observed residues (ATOM records): (download) 
    >6co2D (D:)
fvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdpipldtevt
alsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlreqyglg