PDB entry 6co0

View 6co0 on RCSB PDB site
Description: Crystal Structure of Piper methysticum Styrylpyrone Synthase 1 in complex with p-coumaroyl-CoA
Class: transferase
Keywords: kavalactone biosynthesis, phenylpropanoid pathway, TRANSFERASE
Deposited on 2018-03-10, released 2018-04-11
Made obsolete by 6op5 on 2019-06-12

The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Styrylpyrone synthase 1
    Species: Piper methysticum [TaxId:130404]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CO0
    Domains in SCOPe 2.07: d6co0a1, d6co0a2
  • Chain 'B':
    Compound: Styrylpyrone synthase 1
    Species: Piper methysticum [TaxId:130404]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CO0
    Domains in SCOPe 2.07: d6co0b1, d6co0b2
  • Chain 'C':
    Compound: Styrylpyrone synthase 1
    Species: Piper methysticum [TaxId:130404]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CO0
    Domains in SCOPe 2.07: d6co0c1, d6co0c2
  • Chain 'D':
    Compound: Styrylpyrone synthase 1
    Species: Piper methysticum [TaxId:130404]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CO0
    Domains in SCOPe 2.07: d6co0d1, d6co0d2
  • Chain 'E':
    Compound: Styrylpyrone synthase 1
    Species: Piper methysticum [TaxId:130404]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CO0
    Domains in SCOPe 2.07: d6co0e1, d6co0e2
  • Chain 'F':
    Compound: Styrylpyrone synthase 1
    Species: Piper methysticum [TaxId:130404]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CO0
    Domains in SCOPe 2.07: d6co0f1, d6co0f2
  • Heterogens: WCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6co0A (A:)
    msktvedraaqrakgpatvlaigtatpanvvyqtdypdyyfrvtksehmtklknkfqrmc
    drstikkrymvlteelleknlslctymepsldarqdilvpevpklgkeaadeaiaewgrp
    kseithlifcttcgvdmpgadyqltkllglrssvrrtmlyqqgcfgggtvlrlakdlaen
    nagarvlvvcseittavnfrgpsdthldllvglalfgdgaaavivgadpdptlerplfqi
    vsgaqtilpdsegainghlrevgltirllkdvpglvsmniekclmeafapmgihdwnsif
    wiahpggptildqveaklglkeeklkstravlreygnmssacvlfildevrkrsmeegkt
    ttgegfdwgvlfgfgpgftvetvvlhsmpipkadegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6co0A (A:)
    aaqrakgpatvlaigtatpanvvyqtdypdyyfrvtksehmtklknkfqrmcdrstikkr
    ymvlteelleknlslctymepsldarqdilvpevpklgkeaadeaiaewgrpkseithli
    fcttcgvdmpgadyqltkllglrssvrrtmlyqqgcfgggtvlrlakdlaennagarvlv
    vcseittavnfrgpsdthldllvglalfgdgaaavivgadpdptlerplfqivsgaqtil
    pdsegainghlrevgltirllkdvpglvsmniekclmeafapmgihdwnsifwiahpggp
    tildqveaklglkeeklkstravlreygnmssacvlfildevrkrsmeegktttgegfdw
    gvlfgfgpgftvetvvlhsmpip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6co0B (B:)
    msktvedraaqrakgpatvlaigtatpanvvyqtdypdyyfrvtksehmtklknkfqrmc
    drstikkrymvlteelleknlslctymepsldarqdilvpevpklgkeaadeaiaewgrp
    kseithlifcttcgvdmpgadyqltkllglrssvrrtmlyqqgcfgggtvlrlakdlaen
    nagarvlvvcseittavnfrgpsdthldllvglalfgdgaaavivgadpdptlerplfqi
    vsgaqtilpdsegainghlrevgltirllkdvpglvsmniekclmeafapmgihdwnsif
    wiahpggptildqveaklglkeeklkstravlreygnmssacvlfildevrkrsmeegkt
    ttgegfdwgvlfgfgpgftvetvvlhsmpipkadegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6co0B (B:)
    aqrakgpatvlaigtatpanvvyqtdypdyyfrvtksehmtklknkfqrmcdrstikkry
    mvlteelleknlslctymepsldarqdilvpevpklgkeaadeaiaewgrpkseithlif
    cttcgvdmpgadyqltkllglrssvrrtmlyqqgcfgggtvlrlakdlaennagarvlvv
    cseittavnfrgpsdthldllvglalfgdgaaavivgadpdptlerplfqivsgaqtilp
    dsegainghlrevgltirllkdvpglvsmniekclmeafapmgihdwnsifwiahpggpt
    ildqveaklglkeeklkstravlreygnmssacvlfildevrkrsmeegktttgegfdwg
    vlfgfgpgftvetvvlhsmpip
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6co0C (C:)
    msktvedraaqrakgpatvlaigtatpanvvyqtdypdyyfrvtksehmtklknkfqrmc
    drstikkrymvlteelleknlslctymepsldarqdilvpevpklgkeaadeaiaewgrp
    kseithlifcttcgvdmpgadyqltkllglrssvrrtmlyqqgxfgggtvlrlakdlaen
    nagarvlvvcseittavnfrgpsdthldllvglalfgdgaaavivgadpdptlerplfqi
    vsgaqtilpdsegainghlrevgltirllkdvpglvsmniekclmeafapmgihdwnsif
    wiahpggptildqveaklglkeeklkstravlreygnmssacvlfildevrkrsmeegkt
    ttgegfdwgvlfgfgpgftvetvvlhsmpipkadegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6co0C (C:)
    aqrakgpatvlaigtatpanvvyqtdypdyyfrvtksehmtklknkfqrmcdrstikkry
    mvlteelleknlslctymepsldarqdilvpevpklgkeaadeaiaewgrpkseithlif
    cttcgvdmpgadyqltkllglrssvrrtmlyqqgxfgggtvlrlakdlaennagarvlvv
    cseittavnfrgpsdthldllvglalfgdgaaavivgadpdptlerplfqivsgaqtilp
    dsegainghlrevgltirllkdvpglvsmniekclmeafapmgihdwnsifwiahpggpt
    ildqveaklglkeeklkstravlreygnmssacvlfildevrkrsmeegktttgegfdwg
    vlfgfgpgftvetvvlhsmpip
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6co0D (D:)
    msktvedraaqrakgpatvlaigtatpanvvyqtdypdyyfrvtksehmtklknkfqrmc
    drstikkrymvlteelleknlslctymepsldarqdilvpevpklgkeaadeaiaewgrp
    kseithlifcttcgvdmpgadyqltkllglrssvrrtmlyqqgcfgggtvlrlakdlaen
    nagarvlvvcseittavnfrgpsdthldllvglalfgdgaaavivgadpdptlerplfqi
    vsgaqtilpdsegainghlrevgltirllkdvpglvsmniekclmeafapmgihdwnsif
    wiahpggptildqveaklglkeeklkstravlreygnmssacvlfildevrkrsmeegkt
    ttgegfdwgvlfgfgpgftvetvvlhsmpipkadegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6co0D (D:)
    aqrakgpatvlaigtatpanvvyqtdypdyyfrvtksehmtklknkfqrmcdrstikkry
    mvlteelleknlslctymepsldarqdilvpevpklgkeaadeaiaewgrpkseithlif
    cttcgvdmpgadyqltkllglrssvrrtmlyqqgcfgggtvlrlakdlaennagarvlvv
    cseittavnfrgpsdthldllvglalfgdgaaavivgadpdptlerplfqivsgaqtilp
    dsegainghlrevgltirllkdvpglvsmniekclmeafapmgihdwnsifwiahpggpt
    ildqveaklglkeeklkstravlreygnmssacvlfildevrkrsmeegktttgegfdwg
    vlfgfgpgftvetvvlhsmpip
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6co0E (E:)
    msktvedraaqrakgpatvlaigtatpanvvyqtdypdyyfrvtksehmtklknkfqrmc
    drstikkrymvlteelleknlslctymepsldarqdilvpevpklgkeaadeaiaewgrp
    kseithlifcttcgvdmpgadyqltkllglrssvrrtmlyqqgcfgggtvlrlakdlaen
    nagarvlvvcseittavnfrgpsdthldllvglalfgdgaaavivgadpdptlerplfqi
    vsgaqtilpdsegainghlrevgltirllkdvpglvsmniekclmeafapmgihdwnsif
    wiahpggptildqveaklglkeeklkstravlreygnmssacvlfildevrkrsmeegkt
    ttgegfdwgvlfgfgpgftvetvvlhsmpipkadegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6co0E (E:)
    aqrakgpatvlaigtatpanvvyqtdypdyyfrvtksehmtklknkfqrmcdrstikkry
    mvlteelleknlslctymepsldarqdilvpevpklgkeaadeaiaewgrpkseithlif
    cttcgvdmpgadyqltkllglrssvrrtmlyqqgcfgggtvlrlakdlaennagarvlvv
    cseittavnfrgpsdthldllvglalfgdgaaavivgadpdptlerplfqivsgaqtilp
    dsegainghlrevgltirllkdvpglvsmniekclmeafapmgihdwnsifwiahpggpt
    ildqveaklglkeeklkstravlreygnmssacvlfildevrkrsmeegktttgegfdwg
    vlfgfgpgftvetvvlhsmpip
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6co0F (F:)
    msktvedraaqrakgpatvlaigtatpanvvyqtdypdyyfrvtksehmtklknkfqrmc
    drstikkrymvlteelleknlslctymepsldarqdilvpevpklgkeaadeaiaewgrp
    kseithlifcttcgvdmpgadyqltkllglrssvrrtmlyqqgcfgggtvlrlakdlaen
    nagarvlvvcseittavnfrgpsdthldllvglalfgdgaaavivgadpdptlerplfqi
    vsgaqtilpdsegainghlrevgltirllkdvpglvsmniekclmeafapmgihdwnsif
    wiahpggptildqveaklglkeeklkstravlreygnmssacvlfildevrkrsmeegkt
    ttgegfdwgvlfgfgpgftvetvvlhsmpipkadegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6co0F (F:)
    aqrakgpatvlaigtatpanvvyqtdypdyyfrvtksehmtklknkfqrmcdrstikkry
    mvlteelleknlslctymepsldarqdilvpevpklgkeaadeaiaewgrpkseithlif
    cttcgvdmpgadyqltkllglrssvrrtmlyqqgcfgggtvlrlakdlaennagarvlvv
    cseittavnfrgpsdthldllvglalfgdgaaavivgadpdptlerplfqivsgaqtilp
    dsegainghlrevgltirllkdvpglvsmniekclmeafapmgihdwnsifwiahpggpt
    ildqveaklglkeeklkstravlreygnmssacvlfildevrkrsmeegktttgegfdwg
    vlfgfgpgftvetvvlhsmpip