PDB entry 6cnz

View 6cnz on RCSB PDB site
Description: Crystal Structure of Chorismate Mutase from Burkholderia thailandensis
Class: isomerase
Keywords: SSGCID, Chorismate mutase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, ISOMERASE
Deposited on 2018-03-09, released 2018-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Burkholderia thailandensis [TaxId:57975]
    Gene: AQ477_14105, CRX59_12655
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cnza_
  • Chain 'B':
    Compound: chorismate mutase
    Species: Burkholderia thailandensis [TaxId:57975]
    Gene: AQ477_14105, CRX59_12655
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cnzb_
  • Chain 'C':
    Compound: chorismate mutase
    Species: Burkholderia thailandensis [TaxId:57975]
    Gene: AQ477_14105, CRX59_12655
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cnzc_
  • Chain 'D':
    Compound: chorismate mutase
    Species: Burkholderia thailandensis [TaxId:57975]
    Gene: AQ477_14105, CRX59_12655
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cnzd_
  • Chain 'E':
    Compound: chorismate mutase
    Species: Burkholderia thailandensis [TaxId:57975]
    Gene: AQ477_14105, CRX59_12655
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cnze_
  • Chain 'F':
    Compound: chorismate mutase
    Species: Burkholderia thailandensis [TaxId:57975]
    Gene: AQ477_14105, CRX59_12655
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cnzf_
  • Heterogens: NO3, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cnzA (A:)
    mahhhhhhmadgddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvek
    ratangvdpayartffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltq
    sliaalarvaplrdapdcpsrlarsianwktltrydsaqkdalgtalshvcaaggasavg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cnzA (A:)
    ddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvekratangvdpaya
    rtffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltqsliaalarvapl
    rdapdcpsrlarsianwktltrydsaqkdalgtalshvcaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cnzB (B:)
    mahhhhhhmadgddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvek
    ratangvdpayartffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltq
    sliaalarvaplrdapdcpsrlarsianwktltrydsaqkdalgtalshvcaaggasavg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cnzB (B:)
    dgddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvekratangvdpa
    yartffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltqsliaalarva
    plrdapdcpsrlarsianwktltrydsaqkdalgtalshvca
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cnzC (C:)
    mahhhhhhmadgddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvek
    ratangvdpayartffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltq
    sliaalarvaplrdapdcpsrlarsianwktltrydsaqkdalgtalshvcaaggasavg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cnzC (C:)
    ddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvekratangvdpaya
    rtffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltqsliaalarvapl
    rdapdcpsrlarsianwktltrydsaqkdalgtalshvcaagg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cnzD (D:)
    mahhhhhhmadgddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvek
    ratangvdpayartffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltq
    sliaalarvaplrdapdcpsrlarsianwktltrydsaqkdalgtalshvcaaggasavg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cnzD (D:)
    ddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvekratangvdpaya
    rtffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltqsliaalarvapl
    rdapdcpsrlarsianwktltrydsaqkdalgtalshvca
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6cnzE (E:)
    mahhhhhhmadgddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvek
    ratangvdpayartffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltq
    sliaalarvaplrdapdcpsrlarsianwktltrydsaqkdalgtalshvcaaggasavg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cnzE (E:)
    gddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvekratangvdpay
    artffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltqsliaalarvap
    lrdapdcpsrlarsianwktltrydsaqkdalgtalshvc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6cnzF (F:)
    mahhhhhhmadgddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvek
    ratangvdpayartffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltq
    sliaalarvaplrdapdcpsrlarsianwktltrydsaqkdalgtalshvcaaggasavg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cnzF (F:)
    dtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvekratangvdpayar
    tffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltqsliaalarvaplr
    dapdcpsrlarsianwktltrydsaqkdalgtalshvc