PDB entry 6cnr

View 6cnr on RCSB PDB site
Description: aducanumab apo Fab
Class: immune system
Keywords: antibody Fab fragment, IMMUNE SYSTEM
Deposited on 2018-03-08, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Aducanumab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CNR (0-End)
  • Chain 'L':
    Compound: Aducanumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CNR (0-End)
    Domains in SCOPe 2.07: d6cnrl1, d6cnrl2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6cnrL (L:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cnrL (L:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr