PDB entry 6cng

View 6cng on RCSB PDB site
Description: The X-ray crystal structure of the Streptococcus pneumoniae Fatty Acid Kinase (Fak) B3 protein loaded with linoleic acid to 1.47 Angstrom resolution
Class: transferase
Keywords: Streptococcus pneumoniae, Fatty acid kinase, Linoleic acid, TRANSFERASE
Deposited on 2018-03-08, released 2019-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty Acid Kinase (Fak) B3 protein
    Species: Streptococcus pneumoniae (strain ATCC BAA-255 / R6) [TaxId:171101]
    Gene: spr0652
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cnga_
  • Chain 'D':
    Compound: Fatty Acid Kinase (Fak) B3 protein
    Species: Streptococcus pneumoniae (strain ATCC BAA-255 / R6) [TaxId:171101]
    Gene: spr0652
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cngd_
  • Heterogens: EIC, NA, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cngA (A:)
    mgsshhhhhhssglvprgshmtwkiiadsgcdyrqlptpainttfvsvpltiqvadqvfv
    ddasldidqmmetmyataeasksacpspddylrafegakniflvtitgtlsgshnsaqla
    kniyledhpdtkihvidslsaggevdllveklndlidqglsfeevveaitayqektkllf
    vlakvdnlvkngrlskligtvvgllnirmvgkasetgtlellqkargskksvqaaydelv
    kagyaggrivmaqrnnekccqqlseriretfpqadikilptsglcsfyaeeggllmgyei
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cngA (A:)
    mtwkiiadsgcdyrqlptpainttfvsvpltiqvadqvfvddasldidqmmetmyataea
    sksacpspddylrafegakniflvtitgtlsgshnsaqlakniyledhpdtkihvidsls
    aggevdllveklndlidqglsfeevveaitayqektkllfvlakvdnlvkngrlskligt
    vvgllnirmvgkasetgtlellqkargskksvqaaydelvkagyaggrivmaqrnnekcc
    qqlseriretfpqadikilptsglcsfyaeeggllmgyeid
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cngD (D:)
    mgsshhhhhhssglvprgshmtwkiiadsgcdyrqlptpainttfvsvpltiqvadqvfv
    ddasldidqmmetmyataeasksacpspddylrafegakniflvtitgtlsgshnsaqla
    kniyledhpdtkihvidslsaggevdllveklndlidqglsfeevveaitayqektkllf
    vlakvdnlvkngrlskligtvvgllnirmvgkasetgtlellqkargskksvqaaydelv
    kagyaggrivmaqrnnekccqqlseriretfpqadikilptsglcsfyaeeggllmgyei
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cngD (D:)
    mtwkiiadsgcdyrqlptpainttfvsvpltiqvadqvfvddasldidqmmetmyataea
    sksacpspddylrafegakniflvtitgtlsgshnsaqlakniyledhpdtkihvidsls
    aggevdllveklndlidqglsfeevveaitayqektkllfvlakvdnlvkngrlskligt
    vvgllnirmvgkasetgtlellqkargskksvqaaydelvkagyaggrivmaqrnnekcc
    qqlseriretfpqadikilptsglcsfyaeeggllmgyeid