PDB entry 6cmw

View 6cmw on RCSB PDB site
Description: Crystal structure of zebrafish Phosphatidylinositol-4-phosphate 5- kinase alpha isoform with bound ATP/Ca2+
Class: transferase
Keywords: ATP, PIP5ka, TRANSFERASE
Deposited on 2018-03-06, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol-4-phosphate 5-kinase, type I, alpha
    Species: Danio rerio [TaxId:7955]
    Gene: pip5k1aa, pip5k1a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cmwa_
  • Heterogens: ATP, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cmwA (A:)
    mastgettykkttssalkgaiqlgithsvgslsqkperdvlmqdfevvesiffpsqgsss
    tpghhhgdfkfktyapiafryfremfgirpddylyslcneplielsnpgasgslfyvssd
    defiiktvqhkeaeflqtllpgyfmnlnqnmrtllpkfyglycvqadgknirivvmnnll
    pravpmhlkfdlkgstykrraspkerskgvptykdldfmqdmpegillendhytalsrtm
    qrdcrvlqsfkimdysllvgihilhrageeastavpdtqkkgqgqkplyctaiesiqges
    ksktspqpyesmggipafnskgerllvfigiidilqsyrlvkklehswkallhdgdtvsv
    hrpsfyadrfqkfmcstvfrksqlktlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cmwA (A:)
    ttssalkgaiqlgithsvgslsqkperdvlmqdfevvesiffpsqgssstpghhhgdfkf
    ktyapiafryfremfgirpddylyslcneplielsnpgasgslfyvssddefiiktvqhk
    eaeflqtllpgyfmnlnqnmrtllpkfyglycvqadgknirivvmnnllpravpmhlkfd
    lkgstykrraspkerskgvptykdldfmqdmpegillendhytalsrtmqrdcrvlqsfk
    imdysllvgihilhmggipafnskgerllvfigiidilqsyrtvsvhrpsfyadrfqkfm
    cstvfrk