PDB entry 6cmm

View 6cmm on RCSB PDB site
Description: Crystal Structure of the Human vaccinia-related kinase bound to a N,N-dipropynyl-dihydropteridine inhibitor
Class: Transferase/Transferase Inhibitor
Keywords: transferase, protein kinase domain, Structural Genomics, Structural Genomics Consortium, SGC, Transferase-Transferase Inhibitor Complex
Deposited on 2018-03-05, released 2018-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase VRK1
    Species: Homo sapiens [TaxId:9606]
    Gene: VRK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99986
      • engineered mutation (33-35)
      • engineered mutation (211)
      • engineered mutation (213-214)
      • engineered mutation (292)
      • engineered mutation (294)
    Domains in SCOPe 2.08: d6cmma_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase VRK1
    Species: Homo sapiens [TaxId:9606]
    Gene: VRK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99986
      • engineered mutation (33-35)
      • engineered mutation (211)
      • engineered mutation (213-214)
      • engineered mutation (291-292)
      • engineered mutation (294)
    Domains in SCOPe 2.08: d6cmmb_
  • Chain 'C':
    Compound: Serine/threonine-protein kinase VRK1
    Species: Homo sapiens [TaxId:9606]
    Gene: VRK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99986
      • engineered mutation (33-35)
      • engineered mutation (211)
      • engineered mutation (213-214)
      • engineered mutation (291-292)
      • engineered mutation (294)
    Domains in SCOPe 2.08: d6cmmc_
  • Chain 'D':
    Compound: Serine/threonine-protein kinase VRK1
    Species: Homo sapiens [TaxId:9606]
    Gene: VRK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99986
      • engineered mutation (33-35)
      • engineered mutation (211)
      • engineered mutation (213-214)
      • engineered mutation (291-292)
      • engineered mutation (294)
    Domains in SCOPe 2.08: d6cmmd_
  • Heterogens: ACT, F7D, SO4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cmmA (A:)
    smrvkaaqagrqssakrhlaeqfavgeiitdmaaaawkvglpigqggfgciyladmnsse
    svgsdapcvvkvepsdngplftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhd
    kngksyrfmimdrfgsdlqkiyeanakrfsrktvlqlslrildileyiheheyvhgdika
    snlllnyknpdqvylvdyglayrycpegvhkayaadpkrchdgtieftsidahngvapsr
    rgdleilgycmiqwltghlpwednlkdpkyvrdskiryreniaslmdkcfpaanapgeia
    kymetvklldytekplyenlrdillqglkaigskddgkldlsvvengglkaktitkkraa
    eiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cmmA (A:)
    aeqfavgeiitdmaaaawkvglpigqfgciyladmnssesvgsdapcvvkvepsdngplf
    telkfyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqki
    yeanakrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdygla
    yrycpegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpw
    ednlkdpkyvrdskiryreniaslmdkcfanapgeiakymetvklldytekplyenlrdi
    llqglkaigskddgkldl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cmmB (B:)
    smrvkaaqagrqssakrhlaeqfavgeiitdmaaaawkvglpigqggfgciyladmnsse
    svgsdapcvvkvepsdngplftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhd
    kngksyrfmimdrfgsdlqkiyeanakrfsrktvlqlslrildileyiheheyvhgdika
    snlllnyknpdqvylvdyglayrycpegvhkayaadpkrchdgtieftsidahngvapsr
    rgdleilgycmiqwltghlpwednlkdpkyvrdskiryreniaslmdkcfpaanapgeia
    kymetvklldytekplyenlrdillqglkaigskddgkldlsvvengglkaktitkkraa
    eiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cmmB (B:)
    favgeiitdmaaaawkvglpigqciyladmnssesvgsdapcvvkvepsdngplftelkf
    yqraakpeqiqkwirtrklkylgvpkywgsglhsyrfmimdrfgsdlqkiyeanakrfsr
    ktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyglayrycpegvhk
    ayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwednlkdpkyv
    rdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrdillqglkai
    gskddgkldl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cmmC (C:)
    smrvkaaqagrqssakrhlaeqfavgeiitdmaaaawkvglpigqggfgciyladmnsse
    svgsdapcvvkvepsdngplftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhd
    kngksyrfmimdrfgsdlqkiyeanakrfsrktvlqlslrildileyiheheyvhgdika
    snlllnyknpdqvylvdyglayrycpegvhkayaadpkrchdgtieftsidahngvapsr
    rgdleilgycmiqwltghlpwednlkdpkyvrdskiryreniaslmdkcfpaanapgeia
    kymetvklldytekplyenlrdillqglkaigskddgkldlsvvengglkaktitkkraa
    eiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cmmC (C:)
    eqfavgeiitdmaaaawkvglpigciyladmnssesvgsdapcvvkvepsdngplftelk
    fyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqkiyean
    akrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyglayryc
    pegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwednl
    kdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrdill
    qglkaigskddgkldl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cmmD (D:)
    smrvkaaqagrqssakrhlaeqfavgeiitdmaaaawkvglpigqggfgciyladmnsse
    svgsdapcvvkvepsdngplftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhd
    kngksyrfmimdrfgsdlqkiyeanakrfsrktvlqlslrildileyiheheyvhgdika
    snlllnyknpdqvylvdyglayrycpegvhkayaadpkrchdgtieftsidahngvapsr
    rgdleilgycmiqwltghlpwednlkdpkyvrdskiryreniaslmdkcfpaanapgeia
    kymetvklldytekplyenlrdillqglkaigskddgkldlsvvengglkaktitkkraa
    eiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cmmD (D:)
    favgeiitdmaaaawkvglpigqciyladmnssesvgsdapcvvkvepsdngplftelkf
    yqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqkiyeana
    krfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyglayrycp
    egvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwednlk
    dpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrdillq
    glkaigskddgkldl