PDB entry 6cmj

View 6cmj on RCSB PDB site
Description: Human CAMKK2 with GSK650393
Class: transferase/transferase inhibitor
Keywords: kinase, signaling protein, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2018-03-05, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium/calmodulin-dependent protein kinase kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMKK2, CAMKKB, KIAA0787
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96RR4
      • conflict (33)
    Domains in SCOPe 2.07: d6cmja_
  • Chain 'B':
    Compound: Calcium/calmodulin-dependent protein kinase kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMKK2, CAMKKB, KIAA0787
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96RR4
      • conflict (33)
    Domains in SCOPe 2.07: d6cmjb_
  • Heterogens: F6J, FMT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cmjA (A:)
    mnahhhhhhgsaenlyfqghhvsitgmqdcvqldqytlkdeigkgsygvvklaynendnt
    yyamkvlskkklirqaggciqprgpieqvyqeiailkkldhpnvvklvevlddpnedhly
    mvfelvnqgpvmevptlkplsedqarfyfqdlikgieylhyqkiihrdikpsnllvgedg
    hikiadfgvsnefkgsdallsntvgtpafmapeslsetrkifsgkaldvwamgvtlycfv
    fgqcpfmderimclhskiksqalefpdqpdiaedlkdlitrmldknpesrivvpeiklhp
    wvtrhgaeplpsedenctlve
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cmjA (A:)
    qldqytlkdeigkgsygvvklaynendntyyamkvlskkklirqaggciqprgpieqvyq
    eiailkkldhpnvvklvevlddpnedhlymvfelvnqgpvmevptlkplsedqarfyfqd
    likgieylhyqkiihrdikpsnllvgedghikiadfgvsnefkgsdallsntvgtpafma
    peslsetrkifsgkaldvwamgvtlycfvfgqcpfmderimclhskiksqalefpdqpdi
    aedlkdlitrmldknpesrivvpeiklhpwvtrhgaeplpsedenctl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cmjB (B:)
    mnahhhhhhgsaenlyfqghhvsitgmqdcvqldqytlkdeigkgsygvvklaynendnt
    yyamkvlskkklirqaggciqprgpieqvyqeiailkkldhpnvvklvevlddpnedhly
    mvfelvnqgpvmevptlkplsedqarfyfqdlikgieylhyqkiihrdikpsnllvgedg
    hikiadfgvsnefkgsdallsntvgtpafmapeslsetrkifsgkaldvwamgvtlycfv
    fgqcpfmderimclhskiksqalefpdqpdiaedlkdlitrmldknpesrivvpeiklhp
    wvtrhgaeplpsedenctlve
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cmjB (B:)
    qldqytlkdeigkgsygvvklaynendntyyamkvlskkklirqaggciqprgpieqvyq
    eiailkkldhpnvvklvevlddpnedhlymvfelvnqgpvmevptlkplsedqarfyfqd
    likgieylhyqkiihrdikpsnllvgedghikiadfgvsnefkgsdallsntvgtpafma
    peslsetrkifsgkaldvwamgvtlycfvfgqcpfmderimclhskiksqalefpdqpdi
    aedlkdlitrmldknpesrivvpeiklhpwvtrhgaeplpsedenct