PDB entry 6cmg

View 6cmg on RCSB PDB site
Description: Crystal Structure of the Hendra Virus Attachment G Glycoprotein Bound to a Potent Cross-Reactive Neutralizing Human Monoclonal Antibody m102.3
Class: viral protein/immune system
Keywords: Hendra virus, attachment, glycoprotein, cross-reactive, neutralizing, antibody, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2018-03-05, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoprotein G
    Species: Hendra virus [TaxId:928303]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: m102.3 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CMG (0-End)
    Domains in SCOPe 2.07: d6cmgb1, d6cmgb2
  • Chain 'C':
    Compound: IgG H chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CMG (0-End)
  • Heterogens: NAG, BMA, MAN, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cmgB (B:)
    eivmtqspgtpslspgeratlscrasqsirstylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygrspsfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhklyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cmgB (B:)
    eivmtqspgtpslspgeratlscrasqsirstylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygrspsfgqgtkveikrtvaapsvfifpp
    gtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadye
    khklyacevthqglsspvtksfnrge
    

  • Chain 'C':
    No sequence available.