PDB entry 6cm1

View 6cm1 on RCSB PDB site
Description: MT1-MMP HPX Domain with Blade 2 Loop Bound to Nanodiscs
Class: lipid binding protein
Keywords: MT1-MMP, MMP-14, Nanodisc, lipids, peripheral membrane protein, protease domain, LIPID BINDING PROTEIN
Deposited on 2018-03-02, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix metalloproteinase-14
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cm1a_
  • Chain 'B':
    Compound: apolipoprotein a-I
    Species: Homo sapiens [TaxId:9606]
    Gene: APOA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02647 (0-210)
      • insertion (44-65)
  • Chain 'C':
    Compound: apolipoprotein a-I
    Species: Homo sapiens [TaxId:9606]
    Gene: APOA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02647 (0-210)
      • insertion (44-65)
  • Heterogens: PX4, NA, CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6cm1A (A:)
pnicdgnfdtvamlrgemfvfkerwfwrvrnnqvmdgypmpigqfwrglpasintayerk
dgkfvffkgdkhwvfdeaslepgypkhikelgrglptdkidaalfwmpngktyffrgnky
yrfneelravdseypknikvwegipesprgsfmgsdevftyfykgnkywkfnnqklkvep
gypksalrdwmgcpsg

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.