PDB entry 6clv

View 6clv on RCSB PDB site
Description: Staphylococcus aureus Dihydropteroate Synthase (saDHPS) F17L E208K double mutant structure
Class: antimicrobial protein
Keywords: antibiotic resistance mutations, sulfonamide resistance, ANTIMICROBIAL PROTEIN
Deposited on 2018-03-02, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folP, dpsA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05701
      • engineered mutation (40)
      • engineered mutation (231)
    Domains in SCOPe 2.07: d6clva_
  • Chain 'B':
    Compound: dihydropteroate synthase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folP, dpsA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05701
      • engineered mutation (231)
    Domains in SCOPe 2.07: d6clvb_
  • Chain 'C':
    Compound: dihydropteroate synthase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folP, dpsA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05701
      • engineered mutation (40)
      • engineered mutation (231)
    Domains in SCOPe 2.07: d6clvc_
  • Chain 'D':
    Compound: dihydropteroate synthase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folP, dpsA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05701
      • engineered mutation (231)
    Domains in SCOPe 2.07: d6clvd_
  • Heterogens: 6MB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6clvA (A:)
    mghhhhhhhhhhssghiegrhmlemtktkimgilnvtpdslsdggkfnnvesavtrvkam
    mdegadiidvggvstrpghemitveeelnrvlpvveaivgfdvkisvdtfrsevaeaclk
    lgvdiindqwaglydhrmfqvvakydaeivlmhngngnrdepvveemltsllaqahqaki
    agipsnkiwldpgigfaktrneeaevmarldelvateypvllatsrkrftkkmmgydttp
    verdevtaattaygimkgvravrvhnvelnaklakgidflkenenarhnfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6clvA (A:)
    tktkimgilnvtpdslsnvesavtrvkammdegadiidvggvstrpghemitveeelnrv
    lpvveaivgfdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvakydaeivl
    mhngngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeaevmarld
    elvateypvllatsrkrftkkmmgydttpverdevtaattaygimkgvravrvhnvelna
    klakgidflkenenar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6clvB (B:)
    mghhhhhhhhhhssghiegrhmlemtktkimgilnvtpdslsdggkfnnvesavtrvkam
    mdegadiidvggvstrpghemitveeelnrvlpvveaivgfdvkisvdtfrsevaeaclk
    lgvdiindqwaglydhrmfqvvakydaeivlmhngngnrdepvveemltsllaqahqaki
    agipsnkiwldpgigfaktrneeaevmarldelvateypvllatsrkrftkkmmgydttp
    verdevtaattaygimkgvravrvhnvelnaklakgidflkenenarhnfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6clvB (B:)
    tktkimgilnvvesavtrvkammdegadiidvggvstrpghemitveeelnrvlpvveai
    vgfdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvakydaeivlmhngngn
    rdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeaevmarldelvatey
    pvllatsrkrftkkmmgydttpverdevtaattaygimkgvravrvhnvelnaklakgid
    flkenenar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6clvC (C:)
    mghhhhhhhhhhssghiegrhmlemtktkimgilnvtpdslsdggkfnnvesavtrvkam
    mdegadiidvggvstrpghemitveeelnrvlpvveaivgfdvkisvdtfrsevaeaclk
    lgvdiindqwaglydhrmfqvvakydaeivlmhngngnrdepvveemltsllaqahqaki
    agipsnkiwldpgigfaktrneeaevmarldelvateypvllatsrkrftkkmmgydttp
    verdevtaattaygimkgvravrvhnvelnaklakgidflkenenarhnfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6clvC (C:)
    tktkimgilnvtpdslsnvesavtrvkammdegadiidvggvstrpghemitveeelnrv
    lpvveaivgfdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvakydaeivl
    mhngngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeaevmarld
    elvateypvllatsrkrftkkmmgydttpverdevtaattaygimkgvravrvhnvelna
    klakgidflkenenarh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6clvD (D:)
    mghhhhhhhhhhssghiegrhmlemtktkimgilnvtpdslsdggkfnnvesavtrvkam
    mdegadiidvggvstrpghemitveeelnrvlpvveaivgfdvkisvdtfrsevaeaclk
    lgvdiindqwaglydhrmfqvvakydaeivlmhngngnrdepvveemltsllaqahqaki
    agipsnkiwldpgigfaktrneeaevmarldelvateypvllatsrkrftkkmmgydttp
    verdevtaattaygimkgvravrvhnvelnaklakgidflkenenarhnfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6clvD (D:)
    tktkimgilnvesavtrvkammdegadiidvgmitveeelnrvlpvveaivgfdvkisvd
    tfrsevaeaclklgvdiindqwaglydhrmfqvvakydaeivlmhngngnrdepvveeml
    tsllaqahqakiagipsnkiwldpgigfaktrneeaevmarldelvateypvllatsrkr
    ftkkmmgydttpverdevtaattaygimkgvravrvhnvelnaklakgidflkenenarh