PDB entry 6clu

View 6clu on RCSB PDB site
Description: Staphylococcus aureus Dihydropteroate Synthase (saDHPS) F17L E208K double mutant structure
Class: antimicrobial protein
Keywords: antibiotic resistance mutations, sulfonamide resistance, ANTIMICROBIAL PROTEIN
Deposited on 2018-03-02, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folP, dpsA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05701
      • engineered mutation (40)
      • engineered mutation (231)
    Domains in SCOPe 2.07: d6clua_
  • Chain 'B':
    Compound: dihydropteroate synthase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folP, dpsA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6club_
  • Chain 'C':
    Compound: dihydropteroate synthase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folP, dpsA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05701
      • engineered mutation (231)
    Domains in SCOPe 2.07: d6cluc_
  • Chain 'D':
    Compound: dihydropteroate synthase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folP, dpsA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05701
      • engineered mutation (40)
      • engineered mutation (231)
    Domains in SCOPe 2.07: d6clud_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cluA (A:)
    mghhhhhhhhhhssghiegrhmlemtktkimgilnvtpdslsdggkfnnvesavtrvkam
    mdegadiidvggvstrpghemitveeelnrvlpvveaivgfdvkisvdtfrsevaeaclk
    lgvdiindqwaglydhrmfqvvakydaeivlmhngngnrdepvveemltsllaqahqaki
    agipsnkiwldpgigfaktrneeaevmarldelvateypvllatsrkrftkkmmgydttp
    verdevtaattaygimkgvravrvhnvelnaklakgidflkenenarhnfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cluA (A:)
    tktkimgilnvtpdslsdggkfnnvesavtrvkammdegadiidvggvsmitveeelnrv
    lpvveaivgfdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvakydaeivl
    mhngngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeaevmarld
    elvateypvllatsrkrftkkmmgydttpverdevtaattaygimkgvravrvhnvelna
    klakgidflkene
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cluB (B:)
    mghhhhhhhhhhssghiegrhmlemtktkimgilnvtpdslsdggkfnnvesavtrvkam
    mdegadiidvggvstrpghemitveeelnrvlpvveaivgfdvkisvdtfrsevaeaclk
    lgvdiindqwaglydhrmfqvvakydaeivlmhngngnrdepvveemltsllaqahqaki
    agipsnkiwldpgigfaktrneeaevmarldelvateypvllatsrkrftkkmmgydttp
    verdevtaattaygimkgvravrvhnvelnaklakgidflkenenarhnfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cluB (B:)
    tktkimgilnvnvesavtrvkammdegadiidvgitveeelnrvlpvveaivgfdvkisv
    dtfrsevaeaclklgvdiindqwaglydhrmfqvvakydaeivlmhnpvveemltsllaq
    ahqakiagipsnkiwldpgigftrneeaevmarldelvateypvlladevtaattaygim
    kgvravrvhnvelnaklakgidflkenenarh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cluC (C:)
    mghhhhhhhhhhssghiegrhmlemtktkimgilnvtpdslsdggkfnnvesavtrvkam
    mdegadiidvggvstrpghemitveeelnrvlpvveaivgfdvkisvdtfrsevaeaclk
    lgvdiindqwaglydhrmfqvvakydaeivlmhngngnrdepvveemltsllaqahqaki
    agipsnkiwldpgigfaktrneeaevmarldelvateypvllatsrkrftkkmmgydttp
    verdevtaattaygimkgvravrvhnvelnaklakgidflkenenarhnfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cluC (C:)
    tktkimgilnvnvesavtrvkammdegadiidvgitveeelnrvlpvveaivgfdvkisv
    dtfrsevaeaclklgvdiindqwaglydhrmfqvvakydaeivlmhngepvveemltsll
    aqahqakiagipsnkiwldpgigfaktrneeaevmarldelvateypvllatsrkrftkk
    mmtpverdevtaattaygimkgvravrvhnvelnaklakgidflkenena
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cluD (D:)
    mghhhhhhhhhhssghiegrhmlemtktkimgilnvtpdslsdggkfnnvesavtrvkam
    mdegadiidvggvstrpghemitveeelnrvlpvveaivgfdvkisvdtfrsevaeaclk
    lgvdiindqwaglydhrmfqvvakydaeivlmhngngnrdepvveemltsllaqahqaki
    agipsnkiwldpgigfaktrneeaevmarldelvateypvllatsrkrftkkmmgydttp
    verdevtaattaygimkgvravrvhnvelnaklakgidflkenenarhnfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cluD (D:)
    tktkimgilnvtpdslsdggkfnnvesavtrvkammdegadiidvggveeelnrvlpvve
    aivgfdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvakydaeivlmhngn
    gnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeaevmarldelvat
    eypvllatsrkrftkkmmgydttpverdevtaattaygimkgvravrvhnvelnaklakg
    idflkenenar