PDB entry 6cl7

View 6cl7 on RCSB PDB site
Description: 1.71 A MicroED structure of proteinase K at 0.86 e- / A^2
Class: hydrolase
Keywords: Hydrolase
Deposited on 2018-03-02, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: ELECTRONCRYSTALLOGRAPHY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteinase K
    Species: Parengyodontium album [TaxId:37998]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cl7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cl7A (A:)
    aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
    yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
    rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
    gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
    gkttaasacryiadtankgdlsnipfgtvnllaynnyqa