PDB entry 6cl4

View 6cl4 on RCSB PDB site
Description: LipC12 - Lipase from metagenomics
Class: hydrolase
Keywords: Lipase, HYDROLASE
Deposited on 2018-03-01, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase C12
    Species: Uncultured bacterium [TaxId:77133]
    Gene: lipc12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cl4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cl4A (A:)
    mgsshhhhhhssglvprgshmsasslkfpivlvhgllgfdkiggiypyfygikealekag
    akvyiatlsalnsnelrgeqllefvrkvqaetgaakvnlighsqgplacryvaathpeli
    asvtsvngvnhgsevadlvrlaltpgrlpesianaamsafgqllsalagsprlpqsgiea
    lealtsegvaafnnkypqglpaewggegkelvngvyyyswsgvidynplhqgannldplh
    vamlafsilftnerfqndglvgrysshlgkvigsdysmdhvdainqlagvvanntdpvql
    fvehvarlkskgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cl4A (A:)
    sslkfpivlvhgllgfdkiggiypyfygikealekagakvyiatlsalnsnelrgeqlle
    fvrkvqaetgaakvnlighsqgplacryvaathpeliasvtsvngvnhgsevadlvrlal
    tpgrlpesianaamsafgqllsalagsprlpqsgiealealtsegvaafnnkypqglpae
    wggegkelvngvyyyswsgvidynplhqgannldplhvamlafsilftnerfqndglvgr
    ysshlgkvigsdysmdhvdainqlagvvanntdpvqlfvehvarlkskgl