PDB entry 6ckv

View 6ckv on RCSB PDB site
Description: Solution NMR structure of human BOK
Class: apoptosis
Keywords: apoptosis
Deposited on 2018-03-01, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bcl-2-related ovarian killer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BOK, BCL2L9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UMX3 (Start-157)
      • engineered mutation (47)
      • engineered mutation (80)
      • engineered mutation (117)
      • engineered mutation (132)
    Domains in SCOPe 2.07: d6ckva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ckvA (A:)
    msptdkelvaqakalgreyvharllraglswsaperaapvpgrlaevaavllrlgdelem
    irpsvyrnvarqlhislqservvtdaflavaghifsagitwgkvvslyavaaglavdavr
    qaqpamvhalvdalgefvrktlatwlrrrggwtdvlkc
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ckvA (A:)
    ptdkelvaqakalgreyvharllraglswsaperaapvpgrlaevaavllrlgdelemir
    psvyrnvarqlhislqservvtdaflavaghifsagitwgkvvslyavaaglavdavrqa
    qpamvhalvdalgefvrktlatwlrrrggwtdvlkc