PDB entry 6ckt

View 6ckt on RCSB PDB site
Description: Crystal structure of 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase from Legionella pneumophila Philadelphia 1
Class: transferase
Keywords: SSGCID, transferase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2018-02-28, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: dapD, lpg0888
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZX45 (8-End)
      • expression tag (6-7)
    Domains in SCOPe 2.07: d6ckta1, d6ckta2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cktA (A:)
    mahhhhhhmnslqdlieqafenrqnlsldtassdlinainevlsgldngqfrvaekinge
    wtvhqwlkkavllsfklfpnqiidagfckfydkiplkytdcsneqfqqsgvrvvphamvr
    rgayiakntvlmpsyvnigayidegvmvdtwatvgscaqigknvhisggagiggvleplq
    anptiiedncfigarseivegviveknsvismgvflgqstkiynritgevsygripagsv
    vvagnlpshdgshslycavivkqvdektrakvsindllranqdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cktA (A:)
    hhmnslqdlieqafenrqnlsldtassdlinainevlsgldngqfrvaekingewtvhqw
    lkkavllsfklfpnqiidagfckfydkiplkytdcsneqfqqsgvrvvphamvrrgayia
    kntvlmpsyvnigayidegvmvdtwatvgscaqigknvhisggagiggvleplqanptii
    edncfigarseivegviveknsvismgvflgqstkiynritgevsygripagsvvvagnl
    pshdgshslycavivkqvdektrakvsindllr