PDB entry 6ckq

View 6ckq on RCSB PDB site
Description: Solution structure of the Burkholderia thailandensis transcription antitermination protein NusB (BTH_I1529) - Seattle Structural Genomics Center for Infectious Disease target ButhA.17903.a
Class: transcription
Keywords: infectious disease model, transcription antitermnation, NusA, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSCRIPTION
Deposited on 2018-02-28, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription antitermination protein NusB
    Species: Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264) [TaxId:271848]
    Gene: nusB, BTH_I1529
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2SYC5 (4-148)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d6ckqa1, d6ckqa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ckqA (A:)
    gpgsmkksarrqsrelatqglyqwllsnaapgeidaqlrgalgydkadktlldtilhgvi
    rehatlaeaispsldrpidqlspveravlliatyelthqietpyrviineavelaktfgg
    sdgykyvngvldklavklrpaetqarrga