PDB entry 6ckp

View 6ckp on RCSB PDB site
Description: Crystal structure of a thioredoxin domain 2 from Brucella melitensis at 1.15 Angstrom resolution
Class: electron transport
Keywords: SSGCID, Brucella melitensis, Thioredoxin, domain-2, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, ELECTRON TRANSPORT
Deposited on 2018-02-28, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Brucella melitensis [TaxId:29459]
    Gene: BK187_10725
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Z1ZP61 (21-127)
      • expression tag (9-20)
    Domains in SCOPe 2.07: d6ckpa1, d6ckpa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ckpA (A:)
    mahhhhhhmgtleaqtqgpgsmatvkvdnsnfqsdvlqssepvvvdfwaewcgpcktiap
    aldeiaaemagqvkiakvnidenpelaaqfgvrsiptllmfkdgelaanmvgaapksrla
    dwikasaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ckpA (A:)
    gtleaqtqgpgsmatvkvdnsnfqsdvlqssepvvvdfwaewcgpcktiapaldeiaaem
    agqvkiakvnidenpelaaqfgvrsiptllmfkdgelaanmvgaapksrladwikasaa