PDB entry 6ckm

View 6ckm on RCSB PDB site
Description: N. meningitidis CMP-sialic acid synthetase in the presence of CMP-sialic acid and Ca2+
Class: transferase
Keywords: polysaccharide synthesis, sialic acid-activator, CMP-transferase, transferase
Deposited on 2018-02-28, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acylneuraminate cytidylyltransferase
    Species: Neisseria meningitidis [TaxId:487]
    Gene: neuA, siaB, synB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ckma_
  • Heterogens: NCC, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ckmA (A:)
    mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
    aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
    lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
    ndtaslianncffiaptklyimshqdsididteldlqqaenilnhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ckmA (A:)
    mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
    aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
    lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
    ndtaslianncffiaptklyimshqdsididteldlqqaenilnh