PDB entry 6ckl

View 6ckl on RCSB PDB site
Description: N. meningitidis CMP-sialic acid synthetase in the presence of CMP and Neu5Ac2en
Class: transferase
Keywords: polysaccharide synthesis, sialic acid-activator, CMP-transferase, transferase
Deposited on 2018-02-28, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acylneuraminate cytidylyltransferase
    Species: Neisseria meningitidis [TaxId:487]
    Gene: neuA, siaB, synB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ckla_
  • Chain 'B':
    Compound: N-acylneuraminate cytidylyltransferase
    Species: Neisseria meningitidis [TaxId:487]
    Gene: neuA, siaB, synB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cklb_
  • Chain 'C':
    Compound: N-acylneuraminate cytidylyltransferase
    Species: Neisseria meningitidis [TaxId:487]
    Gene: neuA, siaB, synB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cklc_
  • Heterogens: C5P, CL, DAN, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cklA (A:)
    mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
    aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
    lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
    ndtaslianncffiaptklyimshqdsididteldlqqaenilnhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cklA (A:)
    mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
    aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
    lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
    ndtaslianncffiaptklyimshqdsididteldlqqaenilnh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cklB (B:)
    mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
    aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
    lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
    ndtaslianncffiaptklyimshqdsididteldlqqaenilnhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cklB (B:)
    mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
    aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
    lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
    ndtaslianncffiaptklyimshqdsididteldlqqaenilnh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cklC (C:)
    mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
    aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
    lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
    ndtaslianncffiaptklyimshqdsididteldlqqaenilnhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cklC (C:)
    mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
    aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
    lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
    ndtaslianncffiaptklyimshqdsididteldlqqaenilnh