PDB entry 6cki

View 6cki on RCSB PDB site
Description: Co-crystal structure of MNK2 in Complex With Inhibitor
Class: TRANSFERASE/TRANSFERASE Inhibitor
Keywords: mnk2, TRANSFERASE-TRANSFERASE Inhibitor complex
Deposited on 2018-02-28, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-interacting serine/threonine-protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MKNK2, GPRK7, MNK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HBH9 (2-End)
      • expression tag (0-1)
      • engineered mutation (158)
    Domains in SCOPe 2.07: d6ckia1, d6ckia2
  • Heterogens: ZN, FZJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ckiA (A:)
    gstdsfsgrfedvyqlqedvlgegaharvqtcinlitsqeyavkiiekqpghirsrvfre
    vemlyqcqghrnvlelieffeeedrfylvfekmrggsilshihkrrhfneleasvvvqdv
    asaldflhnkgiahrdlkpenilcehpnqvspvkicdfglgsgiklngdcspistpellt
    pcgsaeymapevveafseeasiydkrcdlwslgvilyillsgyppfvgrcgsdcgwdrge
    acpacqnmlfesiqegkyefpdkdwahiscaakdliskllvrdakqrlsaaqvlqhpwvq
    gcapentlptpmvlqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ckiA (A:)
    gstdsfsgrfedvyqlqedvlgegaharvqtcinlitsqeyavkiiekqpghirsrvfre
    vemlyqcqghrnvlelieffeeedrfylvfekmrggsilshihkrrhfneleasvvvqdv
    asaldflhnkgiahrdlkpenilcehpnqvspvkicdfggsaeymapevveafseeasiy
    dkrcdlwslgvilyillsgyppfvgrccgacpacqnmlfesiqegkyefpdkdwahisca
    akdliskllvrdakqrlsaaqvlqhpwvqgc