PDB entry 6cke

View 6cke on RCSB PDB site
Description: Dehaloperoxidase B in complex with 4-Br-guaiacol
Class: metal binding protein
Keywords: peroxidase, peroxygenase, substrate, METAL BINDING PROTEIN
Deposited on 2018-02-27, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase B
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ckea_
  • Chain 'B':
    Compound: Dehaloperoxidase B
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ckeb_
  • Heterogens: HEM, 3Z7, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ckeA (A:)
    gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ckeB (B:)
    gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk