PDB entry 6ck9

View 6ck9 on RCSB PDB site
Description: Crystal Structure of HIV-1 ConC_Base0 Prefusion Env Trimer in Complex with Human Antibody Fragment 3H109L and 35O22 variants at 3.5 Angstrom
Class: viral protein
Keywords: HIV-1 envelope fusion glycoprotein, VIRAL PROTEIN
Deposited on 2018-02-27, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: gp41 ectodomain of Envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CK9 (Start-152)
  • Chain 'D':
    Compound: 35O22 scFv heavy chain portion
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CK9 (0-End)
    Domains in SCOPe 2.07: d6ck9d_
  • Chain 'E':
    Compound: 35O22 scFv light chain portion
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CK9
    Domains in SCOPe 2.07: d6ck9e_
  • Chain 'G':
    Compound: gp120 of Envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CK9 (0-End)
  • Chain 'H':
    Compound: 3H109L Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CK9 (0-End)
  • Chain 'L':
    Compound: 3H109L Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CK9
    Domains in SCOPe 2.07: d6ck9l1, d6ck9l2
  • Heterogens: NAG, BMA, MAN

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ck9D (D:)
    qgqlvqsgatttkpgssvkiscktsgyrfnfyhinwirqtagrgpewmgwispysgdknl
    apafqdrvimttdtevpvtsftstgaaymeirnltsddtgtyfcakgllrdgsstwlpyl
    wgqgtlltvssast
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ck9D (D:)
    qgqlvqsgatttkpgssvkiscktsgyrfnfyhinwirqtagrgpewmgwispysgdknl
    apafqdrvimttdtevpvtsftstgaaymeirnltsddtgtyfcakgllrdgsstwlpyl
    wgqgtllt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6ck9E (E:)
    sqsvltqsasvsgslgqsvtisctgpnsvccshksiswyqwppgraptliiyednerapg
    isprfsgyksywsayltisdlrpedettyyccsythnsgcvfgtgtkvsvlgqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ck9E (E:)
    vltqsasvsgslgqsvtisctgpnsvccshksiswyqwppgraptliiyednerapgisp
    rfsgyksywsayltisdettyyccsythnsgcvfgtgtkv
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6ck9L (L:)
    svtsyvrplsvalgetasiscgrqalgsravqwyqhrpgqapilliynnqdrpsgiperf
    sgtpdinfgtratltisgveagdeadyychmwdsrsgfswsfggatrltvlgqpkaapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpmqwkmhksyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ck9L (L:)
    syvrplsvalgetasiscgrqalgsravqwyqhrpgqapilliynnqdrpsgiperfsgt
    pdinfgtratltisgveagdeadyychmwdsrsgfswsfggatrltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpmqwkmhksyscqvthegstvektvapt