PDB entry 6ck7

View 6ck7 on RCSB PDB site
Description: Crystal structure of a peptide deformylase from Legionella pneumophila bound to actinonin
Class: hydrolase/antibiotic
Keywords: National Institute of Allergy and Infectious Diseases, NIAID, structural genomics, Legionnaires' disease, formyl-L-methionyl peptide, formate, methionyl peptide, Seattle Structural Genomics Center for Infectious Disease, SSGCID, HYDROLASE-ANTIBIOTIC complex
Deposited on 2018-02-27, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: Legionella pneumophila [TaxId:446]
    Gene: def_2, def, def_1, def_3, A1D14_13265, A9P85_13750, ERS240541_01674, ERS240560_02189, ERS253249_00325, lpymg_02824
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ck7a1, d6ck7a2
  • Chain 'B':
    Compound: Peptide deformylase
    Species: Legionella pneumophila [TaxId:446]
    Gene: def_2, def, def_1, def_3, A1D14_13265, A9P85_13750, ERS240541_01674, ERS240560_02189, ERS253249_00325, lpymg_02824
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ck7b1, d6ck7b2
  • Chain 'C':
    Compound: Peptide deformylase
    Species: Legionella pneumophila [TaxId:446]
    Gene: def_2, def, def_1, def_3, A1D14_13265, A9P85_13750, ERS240541_01674, ERS240560_02189, ERS253249_00325, lpymg_02824
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ck7c1, d6ck7c2
  • Chain 'D':
    Compound: Peptide deformylase
    Species: Legionella pneumophila [TaxId:446]
    Gene: def_2, def, def_1, def_3, A1D14_13265, A9P85_13750, ERS240541_01674, ERS240560_02189, ERS253249_00325, lpymg_02824
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ck7d1, d6ck7d2
  • Heterogens: ZN, BB2, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ck7A (A:)
    mahhhhhhmairkilylpderlrkiakpvetfdeslqtlindmfdtmydargvglaapqi
    gvslrlsvidivgdkkeqivivnpeivsshgekefeegclsvpgaydtvvraekvtvkal
    drfgkpfeitgegllaeclqheidhmngklfvdmlsplkrmmarrkldkfkrlqarkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ck7A (A:)
    hhmairkilylpderlrkiakpvetfdeslqtlindmfdtmydargvglaapqigvslrl
    svidivgdkkeqivivnpeivsshgekefeegclsvpgaydtvvraekvtvkaldrfgkp
    feitgegllaeclqheidhmngklfvdmlsplkrmmarrkldkfkrlqarkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ck7B (B:)
    mahhhhhhmairkilylpderlrkiakpvetfdeslqtlindmfdtmydargvglaapqi
    gvslrlsvidivgdkkeqivivnpeivsshgekefeegclsvpgaydtvvraekvtvkal
    drfgkpfeitgegllaeclqheidhmngklfvdmlsplkrmmarrkldkfkrlqarkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ck7B (B:)
    hhmairkilylpderlrkiakpvetfdeslqtlindmfdtmydargvglaapqigvslrl
    svidivgdkkeqivivnpeivsshgekefeegclsvpgaydtvvraekvtvkaldrfgkp
    feitgegllaeclqheidhmngklfvdmlsplkrmmarrkldkfkrlqarkp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ck7C (C:)
    mahhhhhhmairkilylpderlrkiakpvetfdeslqtlindmfdtmydargvglaapqi
    gvslrlsvidivgdkkeqivivnpeivsshgekefeegclsvpgaydtvvraekvtvkal
    drfgkpfeitgegllaeclqheidhmngklfvdmlsplkrmmarrkldkfkrlqarkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ck7C (C:)
    hhmairkilylpderlrkiakpvetfdeslqtlindmfdtmydargvglaapqigvslrl
    svidivgdkkeqivivnpeivsshgekefeegclsvpgaydtvvraekvtvkaldrfgkp
    feitgegllaeclqheidhmngklfvdmlsplkrmmarrkldkfkrlqarkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ck7D (D:)
    mahhhhhhmairkilylpderlrkiakpvetfdeslqtlindmfdtmydargvglaapqi
    gvslrlsvidivgdkkeqivivnpeivsshgekefeegclsvpgaydtvvraekvtvkal
    drfgkpfeitgegllaeclqheidhmngklfvdmlsplkrmmarrkldkfkrlqarkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ck7D (D:)
    hhmairkilylpderlrkiakpvetfdeslqtlindmfdtmydargvglaapqigvslrl
    svidivgdkkeqivivnpeivsshgekefeegclsvpgaydtvvraekvtvkaldrfgkp
    feitgegllaeclqheidhmngklfvdmlsplkrmmarrkldkfkrlqarkp