PDB entry 6cjz

View 6cjz on RCSB PDB site
Description: Solution Structure of Amebosin
Class: protein fibril
Keywords: amebosin, PROTEIN FIBRIL
Deposited on 2018-02-27, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amoebiasin-1
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: AMS, ICP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6KCA4 (3-104)
      • expression tag (0-2)
      • engineered mutation (41)
      • engineered mutation (60)
      • engineered mutation (62)
    Domains in SCOPe 2.07: d6cjza1, d6cjza2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cjzA (A:)
    gphmsltednnnttitiakgenkeiilhgnpttgyswvvdsseglsntveyvadqhapgi
    sgsggkyhikitgtqtgegkivlvyrrpwapnandrtftlkvnvq