PDB entry 6cjo

View 6cjo on RCSB PDB site
Description: Crystal Structure of Chalcone Isomerase from Medicago Sativa with the G95S mutation.
Class: plant protein, isomerase
Keywords: chalcone isomerase, naringenin, flavanone, PLANT PROTEIN, isomerase
Deposited on 2018-02-26, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chalcone--flavonone isomerase 1
    Species: Medicago sativa [TaxId:3879]
    Gene: CHI1, CHI-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28012 (Start-224)
      • engineered mutation (97)
    Domains in SCOPe 2.07: d6cjoa_
  • Chain 'B':
    Compound: chalcone--flavonone isomerase 1
    Species: Medicago sativa [TaxId:3879]
    Gene: CHI1, CHI-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28012
      • engineered mutation (97)
    Domains in SCOPe 2.07: d6cjob_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cjoA (A:)
    gshmaasitaitvenleypavvtspvtgksyflggagergltiegnfikftaigvyledi
    avaslaakwkgksseelletldfyrdiisgpfeklirsskirelsgpeysrkvmencvah
    lksvgtygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaal
    ienkavssavletmigehavspdlkrclaarlpallnegafkign
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cjoA (A:)
    asitaitvenleypavvtspvtgksyflggagergltiegnfikftaigvylediavasl
    aakwkgksseelletldfyrdiisgpfeklirsskirelsgpeysrkvmencvahlksvg
    tygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienka
    vssavletmigehavspdlkrclaarlpallnegafkign
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cjoB (B:)
    gshmaasitaitvenleypavvtspvtgksyflggagergltiegnfikftaigvyledi
    avaslaakwkgksseelletldfyrdiisgpfeklirsskirelsgpeysrkvmencvah
    lksvgtygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaal
    ienkavssavletmigehavspdlkrclaarlpallnegafkign
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cjoB (B:)
    aasitaitvenleypavvtspvtgksyflggagergltiegnfikftaigvylediavas
    laakwkgksseelletldfyrdiisgpfeklirsskirelsgpeysrkvmencvahlksv
    gtygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienk
    avssavletmigehavspdlkrclaarlpallnegafkig