PDB entry 6cjf

View 6cjf on RCSB PDB site
Description: Human dihydroorotate dehydrogenase bound to 4-quinoline carboxylic acid inhibitor 43
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: Oxidoreductase, oxidoreductase inhibitor, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2018-02-26, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroorotate dehydrogenase (quinone), mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: DHODH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02127 (0-363)
      • expression tag (364-366)
    Domains in SCOPe 2.07: d6cjfa1, d6cjfa2
  • Chain 'B':
    Compound: Dihydroorotate dehydrogenase (quinone), mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: DHODH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02127 (Start-363)
      • expression tag (364-366)
    Domains in SCOPe 2.07: d6cjfb1, d6cjfb2
  • Heterogens: FMN, ORO, F54, ZWI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cjfA (A:)
    gderfyaehlmptlqglldpesahrlavrftslgllprarfqdsdmlevrvlghkfrnpv
    giaagfdkhgeavdglykmgfgfveigsvtpkpqegnprprvfrlpedqavinrygfnsh
    glsvvehrlrarqqkqakltedglplgvnlgknktsvdaaedyaegvrvlgpladylvvn
    vsspntaglrslqgkaelrrlltkvlqerdglrrvhrpavlvkiapdltsqdkediasvv
    kelgidglivtnttvsrpaglqgalrsetgglsgkplrdlstqtiremyaltqgrvpiig
    vggvssgqdalekiragaslvqlytaltfwgppvvgkvkreleallkeqgfggvtdaiga
    dhrrleaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cjfA (A:)
    gderfyaehlmptlqglldpesahrlavrftslgllqdsdmlevrvlghkfrnpvgiaag
    fdkhgeavdglykmgfgfveigsvtpkpqegnprprvfrlpedqavinrygfnshglsvv
    ehrlrarqqkqakltedglplgvnlgknktsvdaaedyaegvrvlgpladylvvnvgkae
    lrrlltkvlqerdglrrvhrpavlvkiapdltsqdkediasvvkelgidglivtnttvsr
    paglqgalrsetgglsgkplrdlstqtiremyaltqgrvpiigvggvssgqdalekirag
    aslvqlytaltfwgppvvgkvkreleallkeqgfggvtdaigadhrrlea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cjfB (B:)
    gderfyaehlmptlqglldpesahrlavrftslgllprarfqdsdmlevrvlghkfrnpv
    giaagfdkhgeavdglykmgfgfveigsvtpkpqegnprprvfrlpedqavinrygfnsh
    glsvvehrlrarqqkqakltedglplgvnlgknktsvdaaedyaegvrvlgpladylvvn
    vsspntaglrslqgkaelrrlltkvlqerdglrrvhrpavlvkiapdltsqdkediasvv
    kelgidglivtnttvsrpaglqgalrsetgglsgkplrdlstqtiremyaltqgrvpiig
    vggvssgqdalekiragaslvqlytaltfwgppvvgkvkreleallkeqgfggvtdaiga
    dhrrleaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cjfB (B:)
    rfyaehlmptlqglldpesahrlavrftslgllsdmlevrvlghkfrnpvgiaagfdkhg
    eavdglykmgfgfveigsvtpkpqegnprprvfrlpedqavinrygfnshglsvvehrlr
    arqqkqakltedglplgvnlgknktsvdaaedyaegvrvlgpladylvvnvsslqgkael
    rrlltkvlqerdglrrvhrpavlvkiapdltsqdkediasvvkelgidglivtnttvsrp
    aglqgalrsetgglsgkplrdlstqtiremyaltqgrvpiigvggvssgqdalekiraga
    slvqlytaltfwgppvvgkvkreleallkeqgfggvtdaigadhrrlea