PDB entry 6cjb

View 6cjb on RCSB PDB site
Description: Crystal structure of Cystathionine beta-lyase from Legionella pneumophila Philadelphia 1 covalently bound to Pyridoxal phosphate
Class: lyase
Keywords: SSGCID, pyridoxal phosphate, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, LYASE
Deposited on 2018-02-26, released 2018-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystathionine beta-lyase
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: metC, lpg0890
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cjba_
  • Chain 'B':
    Compound: Cystathionine beta-lyase
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: metC, lpg0890
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cjbb_
  • Chain 'C':
    Compound: Cystathionine beta-lyase
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: metC, lpg0890
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cjbc_
  • Chain 'D':
    Compound: Cystathionine beta-lyase
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: metC, lpg0890
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6cjbd_
  • Heterogens: LLP, FMT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cjbA (A:)
    mahhhhhhmnkthfdtraihagqepckstgavmtpiyatstykqiapgehlgyeysrtqn
    ptrkayedciaslesgqkgfafasgmaaintvidllgsgdhvvamddlyggtfrlfdkvk
    trtsnlsfsfidmsvpenieaaitpktkllwletpsnpmlklanlrkiaaiakkynlitv
    adntfatpwiqrplelgfdivlhsatkylnghsdvvsgvvvvgdnsvlsdkiaflqnscg
    avagpfdsflvlrslktlsvrmqrhcenanhlanwlsshpkiekviypglkshpqyslak
    eqmnnfggmislvlkgsledakrflarcelftlaeslggvesliehpaimthasipveqr
    kalgiedgfirlsvgiehiddlradlehalg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cjbA (A:)
    kthfdtraihagqepckstgavmtpiyatstykqiapgehlgyeysrtqnptrkayedci
    aslesgqkgfafasgmaaintvidllgsgdhvvamddlyggtfrlfdkvktrtsnlsfsf
    idmsvpenieaaitpktkllwletpsnpmlklanlrkiaaiakkynlitvadntfatpwi
    qrplelgfdivlhsatkylnghsdvvsgvvvvgdnsvlsdkiaflqnscgavagpfdsfl
    vlrslktlsvrmqrhcenanhlanwlsshpkiekviypglkshpqyslakeqmnnfggmi
    slvlkgsledakrflarcelftlaeslggvesliehpaimthasipveqrkalgiedgfi
    rlsvgiehiddlradlehalg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cjbB (B:)
    mahhhhhhmnkthfdtraihagqepckstgavmtpiyatstykqiapgehlgyeysrtqn
    ptrkayedciaslesgqkgfafasgmaaintvidllgsgdhvvamddlyggtfrlfdkvk
    trtsnlsfsfidmsvpenieaaitpktkllwletpsnpmlklanlrkiaaiakkynlitv
    adntfatpwiqrplelgfdivlhsatkylnghsdvvsgvvvvgdnsvlsdkiaflqnscg
    avagpfdsflvlrslktlsvrmqrhcenanhlanwlsshpkiekviypglkshpqyslak
    eqmnnfggmislvlkgsledakrflarcelftlaeslggvesliehpaimthasipveqr
    kalgiedgfirlsvgiehiddlradlehalg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cjbB (B:)
    kthfdtraihagqepckstgavmtpiyatstykqiapgehlgyeysrtqnptrkayedci
    aslesgqkgfafasgmaaintvidllgsgdhvvamddlyggtfrlfdkvktrtsnlsfsf
    idmsvpenieaaitpktkllwletpsnpmlklanlrkiaaiakkynlitvadntfatpwi
    qrplelgfdivlhsatkylnghsdvvsgvvvvgdnsvlsdkiaflqnscgavagpfdsfl
    vlrslktlsvrmqrhcenanhlanwlsshpkiekviypglkshpqyslakeqmnnfggmi
    slvlkgsledakrflarcelftlaeslggvesliehpaimthasipveqrkalgiedgfi
    rlsvgiehiddlradlehalg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cjbC (C:)
    mahhhhhhmnkthfdtraihagqepckstgavmtpiyatstykqiapgehlgyeysrtqn
    ptrkayedciaslesgqkgfafasgmaaintvidllgsgdhvvamddlyggtfrlfdkvk
    trtsnlsfsfidmsvpenieaaitpktkllwletpsnpmlklanlrkiaaiakkynlitv
    adntfatpwiqrplelgfdivlhsatkylnghsdvvsgvvvvgdnsvlsdkiaflqnscg
    avagpfdsflvlrslktlsvrmqrhcenanhlanwlsshpkiekviypglkshpqyslak
    eqmnnfggmislvlkgsledakrflarcelftlaeslggvesliehpaimthasipveqr
    kalgiedgfirlsvgiehiddlradlehalg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cjbC (C:)
    kthfdtraihagqepckstgavmtpiyatstykqiapgehlgyeysrtqnptrkayedci
    aslesgqkgfafasgmaaintvidllgsgdhvvamddlyggtfrlfdkvktrtsnlsfsf
    idmsvpenieaaitpktkllwletpsnpmlklanlrkiaaiakkynlitvadntfatpwi
    qrplelgfdivlhsatkylnghsdvvsgvvvvgdnsvlsdkiaflqnscgavagpfdsfl
    vlrslktlsvrmqrhcenanhlanwlsshpkiekviypglkshpqyslakeqmnnfggmi
    slvlkgsledakrflarcelftlaeslggvesliehpaimthasipveqrkalgiedgfi
    rlsvgiehiddlradlehalg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cjbD (D:)
    mahhhhhhmnkthfdtraihagqepckstgavmtpiyatstykqiapgehlgyeysrtqn
    ptrkayedciaslesgqkgfafasgmaaintvidllgsgdhvvamddlyggtfrlfdkvk
    trtsnlsfsfidmsvpenieaaitpktkllwletpsnpmlklanlrkiaaiakkynlitv
    adntfatpwiqrplelgfdivlhsatkylnghsdvvsgvvvvgdnsvlsdkiaflqnscg
    avagpfdsflvlrslktlsvrmqrhcenanhlanwlsshpkiekviypglkshpqyslak
    eqmnnfggmislvlkgsledakrflarcelftlaeslggvesliehpaimthasipveqr
    kalgiedgfirlsvgiehiddlradlehalg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cjbD (D:)
    kthfdtraihagqepckstgavmtpiyatstykqiapgehlgyeysrtqnptrkayedci
    aslesgqkgfafasgmaaintvidllgsgdhvvamddlyggtfrlfdkvktrtsnlsfsf
    idmsvpenieaaitpktkllwletpsnpmlklanlrkiaaiakkynlitvadntfatpwi
    qrplelgfdivlhsatkylnghsdvvsgvvvvgdnsvlsdkiaflqnscgavagpfdsfl
    vlrslktlsvrmqrhcenanhlanwlsshpkiekviypglkshpqyslakeqmnnfggmi
    slvlkgsledakrflarcelftlaeslggvesliehpaimthasipveqrkalgiedgfi
    rlsvgiehiddlradlehalg