PDB entry 6cj9

View 6cj9 on RCSB PDB site
Description: Crystal structure of lectin from Dioclea lasiophylla seeds (DlyL) complexed with X-Man
Class: sugar binding protein
Keywords: Dioclea lasiophylla, lectin, X-Man., SUGAR BINDING PROTEIN
Deposited on 2018-02-26, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Dioclea lasiophylla [TaxId:1457464]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CJ9 (0-236)
    Domains in SCOPe 2.07: d6cj9a_
  • Heterogens: CA, MN, XMM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cj9A (A:)
    adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
    lsavvsysgtssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
    adanslhfsfsqfsqnpkdlilqgdattdsdgnlqltrvssdgspqgssvgralfyapvh
    iweksavvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpdan