PDB entry 6cj7

View 6cj7 on RCSB PDB site
Description: Crystal structure of Manduca sexta Serine protease inhibitor (Serpin)-12
Class: hydrolase inhibitor
Keywords: Serine protease inhibitor, HYDROLASE INHIBITOR
Deposited on 2018-02-26, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serpin-12
    Species: Manduca sexta [TaxId:7130]
    Database cross-references and differences (RAF-indexed):
    • PDB 6CJ7
    Domains in SCOPe 2.07: d6cj7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cj7A (A:)
    mhhhhhhamaihsgpastsfgvnvfkqmateqsgnlaaspfsitillamlqqgaagntld
    eitralqmtpeksaeifkkvneeiqkrnsrnilktannvflsenfnlnpqfkriavnnfd
    sdltptyfgkpalaaqninswiasktndkidklvspddlsgntqmvmvnavyfkglweip
    freqatqkrnftlnggekkvasfmqtrryfkagthkpamakvvvlpfeyneyslivvlpl
    kssnvdallsslsmedvasfldlppkdvalelpkfsikadinlepvlnkmgvssiftqqa
    elynlgshgslspqvssalhsavltiderggsaaaatsfaavalsydepslyfrankpfl
    ailwdnrssiplfmarimdptleharaaev
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cj7A (A:)
    gpastsfgvnvfkqmateqsgnlaaspfsitillamlqqgaagntldeitralqmtpeks
    aeifkkvneeiqkrnsrnilktannvflsenfnlnpqfkriavnnfdsdltptyfgkpal
    aaqninswiasktndkidklvspddlsgntqmvmvnavyfkglweipfreqatqkrnftl
    nggekkvasfmqtrryfkagthkpamakvvvlpfeyneyslivvlplkssnvdallssls
    medvasfldlppkdvalelpkfsikadinlepvlnkmgvssiftqqaelynlgshgslsp
    qvssalhsavltiderggdepslyfrankpflailwdnrssiplfmarimdptleha