PDB entry 6cii

View 6cii on RCSB PDB site
Description: Crystal structure of Chlamydomonas reinhardtii THB1 in the cyanomet state
Class: heme-binding protein
Keywords: heme-binding protein, heme, globin, truncated hemoglobin, 2-on-2 hemoglobin, cyanide, cyanomet
Deposited on 2018-02-23, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chlamydomonas reinhardtii THB1
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: THB1, CHLREDRAFT_81856
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ciia_
  • Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ciiA (A:)
    aadtapadslysrmggeaavekavdvfyerivadpqlapffanvdmkkqrrkqvafmtyv
    fggsgayegrdlgashrrlireqgmnhhhfdlvaahldstlqelgvaqelkaeamaivas
    arplifgtgeagaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ciiA (A:)
    apadslysrmggeaavekavdvfyerivadpqlapffanvdmkkqrrkqvafmtyvfggs
    gayegrdlgashrrlireqgmnhhhfdlvaahldstlqelgvaqelkaeamaivasarpl
    ifgt