PDB entry 6cig

View 6cig on RCSB PDB site
Description: crystal structure analysis of selenomethionine substituted isoflavone o-methyltransferase
Class: transferase
Keywords: TRANSFERASE, selenomethionine, S-ADENOSYL-L-HOMOCYSTEINE complex, Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC
Deposited on 2018-02-23, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isoflavone-7-O-methyltransferase 8
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ciga1, d6ciga2
  • Heterogens: GOL, T3A, SO4, PG4, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cigA (A:)
    massingrkpseifkaqallykhiyafidsmslkwavemnipniiqnhgkpislsnlvsi
    lqvpsskignvrrlmrylahngffeiitkeeesyaltvasellvrgsdlclapmvecvld
    ptlsgsyhelkkwiyeedltlfgvtlgsgfwdfldknpeyntsfndamasdsklinlalr
    dcdfvfdglesivdvgggtgttakiicetfpklkcivfdrpqvvenlsgsnnltyvggdm
    ftsipnadavllkyilhnwtdkdclrilkkckeavtndgkrgkvtiidmvidkkkdenqv
    tqikllmdvnmaclngkerneeewkklfieagfqhykispltgflslieiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cigA (A:)
    singrkpseifkaqallykhiyafidsmslkwavemnipniiqnhgkpislsnlvsilqv
    psskignvrrlmrylahngffeiitkeeesyaltvasellvrgsdlclapmvecvldptl
    sgsyhelkkwiyeedltlfgvtlgsgfwdfldknpeyntsfndamasdsklinlalrdcd
    fvfdglesivdvgggtgttakiicetfpklkcivfdrpqvvenlsgsnnltyvggdmfts
    ipnadavllkyilhnwtdkdclrilkkckeavtndgkrgkvtiidmvidkkkdenqvtqi
    kllmdvnmaclngkerneeewkklfieagfqhykispltgflslieiyp