PDB entry 6cia

View 6cia on RCSB PDB site
Description: Crystal structure of aldo-keto reductase from Klebsiella pneumoniae in complex with NADPH.
Class: oxidoreductase
Keywords: Structural Genomics, PSI-Biology, Center for Structural Genomics of Infectious Diseases, CSGID, OXIDOREDUCTASE
Deposited on 2018-02-23, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldo/keto reductase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: yhdN_4, yhdN, B1727_06910, B4U21_09420, BN49_2327, CAK82_20800, CQB04_18905, CR230_19100, CTI52_15935, CTI54_15930, PMK1_03573, SAMEA3531778_00013
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ciaa_
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ciaA (A:)
    smvkktvrfgeqaavpaiglgtwymgehaaqrqqevaalragidhgltvidtaemyadgg
    aeevvgqairglrdrvvlvskvypwhagkaamhracenslrrlqtdyldmyllhwrgdip
    lqetveameklvaegkirrwgvsnldtedmqalwrtadgehcatnqvlyhlasrgieydl
    lpwcqqhslpvmaycplaqagrlrdglfqhsdiinmanargitvaqlllawvirhpgvla
    ipkaasiehvvqnaaaldivlsgeelaqldrlypppqrktrldmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ciaA (A:)
    mvkktvrfgeqaavpaiglgtwymgehaaqrqqevaalragidhgltvidtaemyadgga
    eevvgqairglrdrvvlvskvypwhagkaamhracenslrrlqtdyldmyllhwrgdipl
    qetveameklvaegkirrwgvsnldtedmqalwrtadgehcatnqvlyhlasrgieydll
    pwcqqhslpvmaycplaqagrlrdglfqhsdiinmanargitvaqlllawvirhpgvlai
    pkaasiehvvqnaaaldivlsgeelaqldrlypppqrktrldmv