PDB entry 6ci8

View 6ci8 on RCSB PDB site
Description: Structure of the microcompartment-associated aminoacetone dehydrogenase
Class: oxidoreductase
Keywords: dehydrogenase, short-chain dehydrogenase/reductase, OXIDOREDUCTASE
Deposited on 2018-02-23, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase
    Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
    Gene: MSMEG_0269
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QP46 (3-261)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6ci8a1, d6ci8a2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase
    Species: Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) [TaxId:246196]
    Gene: MSMEG_0269
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ci8b_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ci8A (A:)
    gshmftslegrsaivtggskgigrgiaetfanagvdvvitgrnqddldrtvadlsgtrgk
    vtavradvtdpedarrtvaetvsrhggldivcanagifpsgrledltpddieqvlgvnfk
    gtvyivqaalqaltasghgrvvvtssitgpitgypgwshygaskaaqlgflrtaamelap
    kkitinavlpgnimtegldemgqdyldqmasaipagrlgsvadignaalffatdeaayvt
    gqtlvvdggqvlpeshlaiael
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ci8B (B:)
    gshmftslegrsaivtggskgigrgiaetfanagvdvvitgrnqddldrtvadlsgtrgk
    vtavradvtdpedarrtvaetvsrhggldivcanagifpsgrledltpddieqvlgvnfk
    gtvyivqaalqaltasghgrvvvtssitgpitgypgwshygaskaaqlgflrtaamelap
    kkitinavlpgnimtegldemgqdyldqmasaipagrlgsvadignaalffatdeaayvt
    gqtlvvdggqvlpeshlaiael
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ci8B (B:)
    mftslegrsaivtggskgigrgiaetfanagvdvvitgrnqddldrtvadlsgtrgkvta
    vradvtdpedarrtvaetvsrhggldivcanagifpsgrledltpddieqvlgvnfkgtv
    yivqaalqaltasghgrvvvtssitgpitgypgwshygaskaaqlgflrtaamelapkki
    tinavlpgnimtegldemgqdyldqmasaipagrlgsvadignaalffatdeaayvtgqt
    lvvdggqvlpeshlaiael