PDB entry 6ci0

View 6ci0 on RCSB PDB site
Description: Catalytic core subunits (I and II) of cytochrome C oxidase from Rhodobacter sphaeroides with E101A (II) mutation
Class: oxidoreductase
Keywords: Oxidase, electron transfer, proton pumping, OXIDOREDUCTASE
Deposited on 2018-02-23, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: ctaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ci0a_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: ctaC, coxII, ctaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03736 (Start-252)
      • engineered mutation (72)
      • expression tag (253-256)
    Domains in SCOPe 2.07: d6ci0b1, d6ci0b2, d6ci0b3
  • Chain 'C':
    Compound: Cytochrome c oxidase subunit 1
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: ctaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ci0c_
  • Chain 'D':
    Compound: Cytochrome c oxidase subunit 2
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: ctaC, coxII, ctaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03736 (0-252)
      • engineered mutation (72)
      • expression tag (253-256)
    Domains in SCOPe 2.07: d6ci0d1, d6ci0d2, d6ci0d3
  • Heterogens: DMU, TRD, CU, MG, CA, HEA, MAL, CD, HTH, TRS, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ci0A (A:)
    ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf
    fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafp
    rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl
    sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd
    rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm
    vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsie
    lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi
    yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv
    sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ci0B (B:)
    sleiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrn
    kvparfthnsplaiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwywgye
    ypdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnktvvv
    qvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympitvk
    vvseeayaawleqhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ci0B (B:)
    leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
    vparfthnsplaiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwywgyey
    pdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnktvvvq
    vtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympitvkv
    vseeayaawleqhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ci0C (C:)
    ftrwfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgf
    fqslwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafp
    rmnnlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhl
    sgassilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltd
    rnfgttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpm
    vyamvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsie
    lktpmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagi
    yfwigkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfv
    sslgaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppehtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ci0C (C:)
    wfmstnhkdigvlylftgglvglisvaftvymrmelmapgvqfmcaehlesglvkgffqs
    lwpsavenctpnghlwnvmitghgilmmffvvipalfggfgnyfmplhigapdmafprmn
    nlsywlyvagtslavaslfapggngqlgsgigwvlypplstsesgystdlaifavhlsga
    ssilgainmittflnmrapgmtmhkvplfawsifvtawlillalpvlagaitmlltdrnf
    gttffqpsgggdpvlyqhilwffghpevyiivlpafgivshviatfakkpifgylpmvya
    mvaigvlgfvvwahhmytaglsltqqsyfmmatmviavptgikifswiatmwggsielkt
    pmlwalgflflftvggvtgivlsqasvdryyhdtyyvvahfhyvmslgavfgifagiyfw
    igkmsgrqypewagklhfwmmfvganltffpqhflgrqgmprryidypeafatwnfvssl
    gaflsfasflfflgvifytltrgarvtannywnehadtlewtltspppeht
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ci0D (D:)
    sleiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrn
    kvparfthnsplaiawtivpivilvaigafslpvlfnqqeipeadvtvkvtgyqwywgye
    ypdeeisfesymigspatggdnrmspeveqqlieagysrdefllatdtamvvpvnktvvv
    qvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiffgqcselcgishaympitvk
    vvseeayaawleqhhhh