PDB entry 6chz

View 6chz on RCSB PDB site
Description: Estrogen Receptor Alpha Y537S bound to antagonist H3B-9224.
Class: nuclear protein/antagonist
Keywords: Nuclear hormone receptor, antagonist, activating mutation, breast cancer, NUCLEAR PROTEIN, nuclear protein-antagonist complex
Deposited on 2018-02-23, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372 (15-End)
      • expression tag (14)
      • engineered mutation (89)
      • engineered mutation (125)
      • engineered mutation (245)
    Domains in SCOPe 2.07: d6chza1, d6chza2
  • Heterogens: F3D, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6chzA (A:)
    mghhhhhhenlyfqlalsltadqmvsalldaeppilyseydptrpfseasmmglltnlad
    relvhminwakrvpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllld
    rnqgksvegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlkslee
    kdhihrvldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkck
    nvvplsdlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >6chzA (A:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemld
    ahrlha