PDB entry 6chk

View 6chk on RCSB PDB site
Description: Crystal structure of LacI family transcriptional regulator from Lactobacillus casei, Target EFI-512911, with bound TRIS
Class: transcription
Keywords: Transcriptional Regulator, Lactobacillus casei, Structural Genomics, TRANSCRIPTION
Deposited on 2018-02-22, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, LacI family
    Species: Lactobacillus paracasei [TaxId:321967]
    Gene: LSEI_2103
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6chka_
  • Heterogens: TRS, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6chkA (A:)
    smlraqatgnigvlvsrvtnpffaglfdaierelhahgyqvmitqtyddpeaeerflkql
    ksreldgvilasveapdrvmavakafpgrvvvvnadvqipgatslvlphyqatrdaldyl
    fnqghrrfayvsggtisgahhgqsrtqafldfmqahqllvaqdllfgqihtakegqavgk
    qlaslapnvrpdavftnsdevavgvidsllaadvkvpddiavmgyddqpfapfakipltt
    vhqpvasmaaaathellkglgrqvaqdtqptlhlslkirqsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6chkA (A:)
    tgnigvlvsrvtnpffaglfdaierelhahgyqvmitqtyddpeaeerflkqlksreldg
    vilasveapdrvmavakafpgrvvvvnadvqipgatslvlphyqatrdaldylfnqghrr
    fayvsggtisqsrtqafldfmqahqllvaqdllfgqihtakegqavgkqlaslapnvrpd
    avftnsdevavgvidsllaadvkvpddiavmgyddqpfapfakiplttvhqpvasmaaaa
    thellkglgrqvaqdtqptlhlslkirqsa