PDB entry 6chd

View 6chd on RCSB PDB site
Description: Crystal Structure of Human Lysyl-tRNA Synthetase complexed with L-Lysylsulfamoyl Adenosine
Class: ligase,transferase
Keywords: ATP binding, aminoacylation, amino acid binding, ATP adenylyltransferase activity, tRNA binding, LIGASE, TRANSFERASE, Structure-guided Drug Discovery Consortium
Deposited on 2018-02-22, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine--tRNA ligase
    Species: Homo sapiens [TaxId:9606]
    Gene: KARS, KIAA0070
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6chda1, d6chda2
  • Chain 'B':
    Compound: Lysine--tRNA ligase
    Species: Homo sapiens [TaxId:9606]
    Gene: KARS, KIAA0070
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6chdb1, d6chdb2
  • Heterogens: KAA, SO4, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6chdA (A:)
    maavqaaevkvdgsepklsknelkrrlkaekkvaekeakqkelsekqlsqataaatnhtt
    dngvgpeeesvdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdh
    ltditlkvagrihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgd
    iigvqgnpgktkkgelsiipyeitllspclhmlphlhfglkdketryrqryldlilndfv
    rqkfiirskiityirsfldelgfleietpmmniipggavakpfityhneldmnlymriap
    elyhkmlvvggidrvyeigrqfrnegidlthnpefttcefymayadyhdlmeitekmvsg
    mvkhitgsykvtyhpdgpegqaydvdftppfrrinmveelekalgmklpetnlfeteetr
    kilddicvakavecppprttarlldklvgeflevtcinptficdhpqimsplakwhrske
    glterfelfvmkkeicnaytelndpmrqrqlfeeqakakaagddeamfidenfctaleyg
    lpptagwgmgidrvamfltdsnnikevllfpamkpedkkenvattdtlesttvgtsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6chdA (A:)
    vdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvag
    rihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgk
    tkkgelsiipyeitllspclhmlphlhfglkdketryrqryldlilndfvrqkfiirski
    ityirsfldelgfleietpmmniipggavakpfityhneldmnlymriapelyhkmlvvg
    gidrvyeigrqfrnegidlthnpefttcefymayadyhdlmeitekmvsgmvkhitgsyk
    vtyhpdgpegqaydvdftppfrrinmveelekalgmklpetnlfeteetrkilddicvak
    avecppprttarlldklvgeflevtcinptficdhpqimsplakwhrskeglterfelfv
    mkkeicnaytelndpmrqrqlfeeqakakaagddeamfidenfctaleyglpptagwgmg
    idrvamfltdsnnikevllfpamkpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6chdB (B:)
    maavqaaevkvdgsepklsknelkrrlkaekkvaekeakqkelsekqlsqataaatnhtt
    dngvgpeeesvdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdh
    ltditlkvagrihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgd
    iigvqgnpgktkkgelsiipyeitllspclhmlphlhfglkdketryrqryldlilndfv
    rqkfiirskiityirsfldelgfleietpmmniipggavakpfityhneldmnlymriap
    elyhkmlvvggidrvyeigrqfrnegidlthnpefttcefymayadyhdlmeitekmvsg
    mvkhitgsykvtyhpdgpegqaydvdftppfrrinmveelekalgmklpetnlfeteetr
    kilddicvakavecppprttarlldklvgeflevtcinptficdhpqimsplakwhrske
    glterfelfvmkkeicnaytelndpmrqrqlfeeqakakaagddeamfidenfctaleyg
    lpptagwgmgidrvamfltdsnnikevllfpamkpedkkenvattdtlesttvgtsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6chdB (B:)
    svdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkva
    grihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpg
    ktkkgelsiipyeitllspclhmlplkdketryrqryldlilndfvrqkfiirskiityi
    rsfldelgfleietpmmniipggavakpfityhneldmnlymriapelyhkmlvvggidr
    vyeigrqfrnegidlthnpefttcefymayadyhdlmeitekmvsgmvkhitgsykvtyh
    pdgpegqaydvdftppfrrinmveelekalgmklpetnlfeteetrkilddicvakavec
    ppprttarlldklvgeflevtcinptficdhpqimsplakwhrskeglterfelfvmkke
    icnaytelndpmrqrqlfeeqakakaagddeamfidenfctaleyglpptagwgmgidrv
    amfltdsnnikevllfpamkpe