PDB entry 6ch5

View 6ch5 on RCSB PDB site
Description: Dehaloperoxidase B in complex with substrate 4-Nitroguaiacol
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2018-02-21, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase B
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ch5a_
  • Chain 'B':
    Compound: Dehaloperoxidase B
    Species: Amphitrite ornata [TaxId:129555]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ch5b_
  • Heterogens: HEM, SO4, GOL, F0M, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ch5A (A:)
    gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ch5B (B:)
    gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
    nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk