PDB entry 6cgu

View 6cgu on RCSB PDB site
Description: mouse cadherin-6 EC1-2 adhesive fragment
Class: cell adhesion
Keywords: Cadherin EC domain Dimer Extracellular, CELL ADHESION
Deposited on 2018-02-20, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cadherin-6
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cgua1, d6cgua2
  • Chain 'B':
    Compound: Cadherin-6
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cgub1, d6cgub2
  • Chain 'C':
    Compound: Cadherin-6
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cguc1, d6cguc2
  • Chain 'D':
    Compound: Cadherin-6
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cgud1, d6cgud2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cguA (A:)
    swmwnqfflleeytgsdyqyvgklhsdqdrgdgslkyilsgdgagdlfiinentgdiqat
    krldreekpvyilraqavnrrtgrpvepesefiikihdindnepiftkdvytatvpemad
    vgtfvvqvtatdaddptygnsakvvysilqgqpyfsvesetgiiktallnmdrenreqyq
    vviqakdmggqmgglsgtttvnitltd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cguB (B:)
    swmwnqfflleeytgsdyqyvgklhsdqdrgdgslkyilsgdgagdlfiinentgdiqat
    krldreekpvyilraqavnrrtgrpvepesefiikihdindnepiftkdvytatvpemad
    vgtfvvqvtatdaddptygnsakvvysilqgqpyfsvesetgiiktallnmdrenreqyq
    vviqakdmggqmgglsgtttvnitltd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cguC (C:)
    swmwnqfflleeytgsdyqyvgklhsdqdrgdgslkyilsgdgagdlfiinentgdiqat
    krldreekpvyilraqavnrrtgrpvepesefiikihdindnepiftkdvytatvpemad
    vgtfvvqvtatdaddptygnsakvvysilqgqpyfsvesetgiiktallnmdrenreqyq
    vviqakdmggqmgglsgtttvnitltd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cguD (D:)
    swmwnqfflleeytgsdyqyvgklhsdqdrgdgslkyilsgdgagdlfiinentgdiqat
    krldreekpvyilraqavnrrtgrpvepesefiikihdindnepiftkdvytatvpemad
    vgtfvvqvtatdaddptygnsakvvysilqgqpyfsvesetgiiktallnmdrenreqyq
    vviqakdmggqmgglsgtttvnitltd