PDB entry 6cgf

View 6cgf on RCSB PDB site
Description: Crystal structure of HIV-1 Y188L mutant reverse transcriptase in complex with non-nucleoside inhibitor K-5a2
Class: replication
Keywords: non-nucleoside inhibitor, REPLICATION
Deposited on 2018-02-20, released 2018-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Reverse transcriptase/ribonuclease H
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11678]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (2-End)
      • initiating methionine (0)
      • expression tag (1)
      • engineered mutation (173-174)
      • engineered mutation (189)
      • engineered mutation (281)
    Domains in SCOPe 2.08: d6cgfa1, d6cgfa2
  • Chain 'B':
    Compound: p51 RT
    Species: Human immunodeficiency virus type 1 group M subtype B [TaxId:11678]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (Start-427)
      • engineered mutation (279)
    Domains in SCOPe 2.08: d6cgfb_
  • Heterogens: K5A, MG, NA, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cgfA (A:)
    mvpispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpynt
    pvfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsv
    pldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdi
    viyqymddllvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdk
    wtvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkaltevipltee
    aelelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmr
    gahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvn
    tpplvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqkte
    lqaiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpa
    hkgiggneqvdklvsag
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cgfA (A:)
    mvpispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpynt
    pvfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsv
    pldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdi
    viyqymddllvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdk
    wtvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkaltevipltee
    aelelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmr
    gahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvn
    tpplvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqkte
    lqaiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpa
    hkgiggneqvdklvsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cgfB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cgfB (B:)
    pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfai
    kkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplded
    frkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqy
    mddlyvgsdleigqhrtkieelrqhllrwgppflwmgyelhpdkwtvqpivlpekdswtv
    ndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeaelelaenreilkepv
    hgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqk
    ittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyq