PDB entry 6cge

View 6cge on RCSB PDB site
Description: Crystal structure of human 17beta-HSD type 1 in ternary complex with PBRM and NADP+
Class: oxidoreductase
Keywords: Inhibitor, Complex, Hydroxysteroid Dehydrogenase, OXIDOREDUCTASE
Deposited on 2018-02-20, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estradiol 17-beta-dehydrogenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B1, E17KSR, EDH17B1, EDH17B2, EDHB17, SDR28C1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cgea_
  • Chain 'B':
    Compound: Estradiol 17-beta-dehydrogenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B1, E17KSR, EDH17B1, EDH17B2, EDHB17, SDR28C1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cgeb_
  • Heterogens: F0D, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cgeA (A:)
    martvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsl
    etlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtv
    rmlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvh
    lsliecgpvhtafmekvlgspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaev
    fltalrapkptlryftterflpllrmrlddpsgsnyvtamhrevfgdvpakaeagaeagg
    gagpgaedeagrgavgdpelgdppaapq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cgeA (A:)
    artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
    tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
    mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
    sliecgpvhtlgspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaevfltalra
    pkptlryftterflpllrmrlddpsgsnyvtamhrevfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cgeB (B:)
    martvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsl
    etlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtv
    rmlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvh
    lsliecgpvhtafmekvlgspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaev
    fltalrapkptlryftterflpllrmrlddpsgsnyvtamhrevfgdvpakaeagaeagg
    gagpgaedeagrgavgdpelgdppaapq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cgeB (B:)
    artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
    tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
    mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
    sliecgpvhtspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaevfltalrapk
    ptlryftterflpllrmrlddpsgsnyvtamhrevfg