PDB entry 6cgb

View 6cgb on RCSB PDB site
Description: chimera of mouse cadherin-11 EC1 and mouse cadherin-6 EC2
Class: cell adhesion
Keywords: Cadherin EC domain Dimer Extracellular, CELL ADHESION
Deposited on 2018-02-19, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cadherin-11, Cadherin-6 chimera
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cgba1, d6cgba2
  • Heterogens: CA, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cgbA (A:)
    gwvwnqffvieeytgpdpvlvgrlhsdidsgdgnikyilsgegagtifviddksgnihat
    ktldreeraqytlmaqavdrdtnrpleppsefivkvqdindnepiftkdvytatvpemad
    vgtfvvqvtatdaddptygnsakvvysilqgqpyfsvesetgiiktallnmdrenreqyq
    vviqakdmggqmgglsgtttvnitltd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cgbA (A:)
    gwvwnqffvieeytgpdpvlvgrlhsdidsgdgnikyilsgegagtifviddksgnihat
    ktldreeraqytlmaqavdrdtnrpleppsefivkvqdindnepiftkdvytatvpemad
    vgtfvvqvtatdaddptygnsakvvysilqgqpyfsvesetgiiktallnmnreqyqvvi
    qakdmggqmgglsgtttvnitltd